KEGG   Sorghum bicolor (sorghum): SORBI_05g020210Help
Entry
SORBI_05g020210   CDS       T01086                                 

Gene name
SORBIDRAFT_05g020210, Sb05g020210
Definition
hypothetical protein
Orthology
K00660  
chalcone synthase [EC:2.3.1.74]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Circadian rhythm - plant
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Biosynthesis of other secondary metabolites
   00941 Flavonoid biosynthesis
    SORBI_05g020210 (SORBIDRAFT_05g020210)
 Organismal Systems
  Environmental adaptation
   04712 Circadian rhythm - plant
    SORBI_05g020210 (SORBIDRAFT_05g020210)
Enzymes [BR:sbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.74  naringenin-chalcone synthase
     SORBI_05g020210 (SORBIDRAFT_05g020210)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 401 aa AA seqDB search
MAAATVTVEEVRKAQRATGPATVLAIGTATPANCVHQADYPDYYFRITKSEHMTDLKEKF
KRMCDKSQIRKRYMHLTEEYLAENPNMCAYMAPSLDARQDIVVVEVPKLGKAAAQKAIKE
WGQPKSKITHLVFCTTSGVDMPGADYQLTKMLGLRPSVNRLMMYQQGCFAGGTVLRVAKD
LAENNRGARVLVVCSEITAVTFRGPSESHLDSMVGQALFGDGAAAVIVGADPDERVERPL
FQLVSASQTILPDSEGAIDGHLREVGLTFHLLKDVPGLISKNIERSLEEAFKPLGITDYN
SIFWVAHPGGPAILDQVEAKVGLEKERLRATRHVLSEYGNMSSACVLFILDEMRKRSAED
GQATTGEGFDWGVLFGFGPGLTVETVVLHSVPITTGAAITA
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcgactgtgaccgtggaggaggtgaggaaggcgcagcgcgcgacgggcccg
gccaccgtgctggcgatcgggacggcgacgccggccaactgcgtgcaccaggccgactac
ccggactactacttccggatcacaaagagcgagcacatgaccgacctcaaggagaagttc
aagaggatgtgcgacaagtcgcagatccgaaagcggtacatgcacctgacggaggagtac
ctggcggagaaccctaacatgtgtgcgtacatggcgccgtcgctggacgcccgccaggac
atcgtggtggtggaggtccccaagctgggcaaggccgcggcgcagaaggcgatcaaggag
tgggggcagccgaaatccaagatcacccatctcgtcttctgcaccacctccggcgtcgac
atgcccggcgccgactaccagctcaccaagatgctcggcctgcggccctcggtgaaccgt
ctgatgatgtaccagcaggggtgcttcgcgggcggcacggtgctgcgcgtggccaaggac
ctcgccgagaacaaccgcggggcgcgcgtcctggtggtgtgctccgagatcaccgcggtc
acgttccggggaccctccgagtcccaccttgactccatggttggccaagcgctgttcggc
gacggcgctgcggcggttattgtgggagctgaccctgacgagcgcgtggagcgcccgctg
ttccagctcgtgtcggcgtcgcagacaatcctgccggactccgagggcgccatcgacggc
cacctccgcgaggtcgggctcacgttccacctgctcaaggacgtgcccgggctcatctcc
aagaacatagagcgctcgctggaggaggcgttcaagccgctggggatcaccgactacaac
tccatcttctgggtggcgcaccctggcgggccagcgattctggaccaggtggaggccaag
gtcgggctggagaaggagcggctgcgtgccacgcgccatgtcctatctgagtacggcaac
atgtccagcgcgtgcgtgctcttcatcctcgacgagatgcgcaagcgctccgccgaagac
ggccaggccaccaccggtgaaggcttcgactggggcgtgctcttcggcttcggccccggg
ctcaccgtcgagaccgtcgtgctccacagcgttcccatcaccaccggagcggccatcacc
gcctga

DBGET integrated database retrieval system