KEGG   Sorghum bicolor (sorghum): SORBI_05g020380Help
Entry
SORBI_05g020380   CDS       T01086                                 

Gene name
SORBIDRAFT_05g020380, Sb05g020380
Definition
hypothetical protein
Orthology
K13447  
respiratory burst oxidase [EC:1.6.3.- 1.11.1.-]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Plant-pathogen interaction
Class
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:sbi04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 936 aa AA seqDB search
MHNPRPGGGDIVEMSSSSSAAAPHEAGARDRERVIPHSGPLSKKTGARKSARFAESVSAP
LTAPPPPRASSANNNDDDDDYVEITLDVRDDSVAVHSVKPAHGGGGGGDDSDVTLLARTL
ENRRASGHSVIRNASSRIKQVSQELRRIASINRRGGGGGARLDRSKSAAAHALKGLKFIS
KAEGAAGWEAVEKRFDKLAENGLLHRSKFGQCIGMKEPEFAGELFDALSRRRNISGDSIS
KAELLEFWDQISDTSFDGRLQTFFDMVDKDADGRITEEEVKEIITLSASANKLSKITDQA
EEYARLIMEELDPANLGYIELYNLEMLLLQAPSQSVRIGTTNSRNLSQMLSQSLRPTPEP
NPLRRWYRRVHYFLEDNWRRVWVLLLWLSICAALFAWKFTQYRRRYVFHVMGYCVCVAKG
GAETLKFNMALILLPVCRNTITWLRNRTTAVARVVPFDDSLNFHKVVAVGITVGAALHIV
SHLTCDFPRLLHATDEAYAPLGQYFGTRRPPDYWWFVKGTEGWTGLVMLVLMAVAFTLAT
PWFRRGRVALPGPVLRRLTGFNAFWYSHHCFVAVYALLVVHGQYLYLTHKWYKKSTWMYL
AVPVALYACERLTRALRSSVRPVKILKVAVYPGNVLSLHFSKPQGFRYRSGQYIFVNCAA
VSPFQWHPFSITSAPQDDYVSVHIRTLGDWTRELKNVFSRVCRPPTEGKSGLLRAEYDRD
GSAMANPSFPKVLIDGPYGAPAQDYKQYDIVLLVGLGIGATPMISIIKDIINNMKQPDGD
LEAGAGADTSASSMASSFRTRRAYFYWVTREQGSFEWFRGVMDEVAETDKKGVIELHNYC
TSVYEEGDARSALIAMLQSLNHAKHGVDVVSGTRVKTHFARPNWRNVYKRIALNHQNQRV
GVFYCGAPVLTKELRELAQDFSRKTNTKFEFHKENF
NT seq 2811 nt NT seq  +upstreamnt  +downstreamnt
atgcataacccgaggccgggcggcggtgacatcgtcgagatgtcgtcgtcgtcgtccgcc
gccgcgccgcacgaggcgggagccagggacagggagcgcgtgatcccacacagcggcccg
ctgagcaagaagaccggggcgaggaagagcgcgcggttcgccgagtccgtgtccgcgcct
ctcaccgcgccgccgccgccgcgcgcgtcgtccgccaacaacaacgacgacgacgacgac
tacgtggagatcaccctcgacgtgcgcgacgactcggtggcggtgcacagcgtcaagccc
gcccacggcggcggcggcggcggagacgactcggacgtgacgctgctggcgcgcacgctg
gagaaccggcgggcgtccggccactcggtgatccggaacgcctcgtcgcggatcaagcag
gtgtcgcaggagctccgccgcatcgcctccatcaaccgccgcggcggcggcggcggggcg
aggctggaccggtccaagtccgcggccgcgcacgcgctcaaggggctcaagttcatcagc
aaggccgagggcgccgccggatgggaggccgtcgagaagcgcttcgacaagctcgccgag
aacgggctcctccaccgctccaagttcggccagtgcatcgggatgaaggagccggagttc
gccggcgagctgttcgacgcgctgtctcggcgccgcaacatctccggcgacagcatcagc
aaggccgagctgctcgagttctgggaccaaatctccgacaccagcttcgacggccgcctg
cagaccttcttcgacatggtcgacaaggacgcggacggcaggatcaccgaggaggaggtc
aaagagatcatcacgctgagcgcgtcagcgaacaagctgtcgaagatcacagatcaagcg
gaggagtacgctcgtctaatcatggaggagctagaccctgccaacctgggctacatcgag
ctctacaacctggagatgctgctcctccaagctccgtcccaatccgtgcggatcggcacc
accaacagccggaacctgagccagatgctgtcgcagagcctccgcccgacgccggagccg
aacccgctccggcgctggtaccgccgcgtgcactacttcctggaggacaactggcggcgc
gtgtgggtgctcctcctgtggctctccatctgcgccgcgctcttcgcctggaagttcacc
cagtaccgccgccgctacgtcttccacgtgatgggctactgcgtctgcgtcgcgaagggc
ggcgccgagacgctcaagttcaacatggcgctcatcctcctgcccgtctgccggaacacc
atcacctggctccgcaaccggaccaccgccgtggcgcgcgtcgtccccttcgacgacagc
ctcaacttccacaaggtggtcgccgtcgggatcaccgtgggcgccgcgctccacatcgtc
tcccacctgacgtgcgacttcccgcggctcctccacgccaccgacgaggcgtacgcgccg
ctggggcagtacttcgggacgcggcggccgccggactactggtggttcgtgaagggcacg
gaggggtggacggggctggtgatgctggtgctcatggcggtggcgttcacgctggcgacg
ccgtggttcaggagagggagggtggcgctgccgggccccgtgctcaggcggctcaccggg
ttcaacgcgttctggtactcgcaccactgcttcgtggcggtgtacgcgctgctcgtcgtg
cacgggcagtacctgtacctgacgcacaagtggtacaagaagtcgacgtggatgtacctg
gccgtgcccgtggcgctgtacgcgtgcgagaggctgacgagggcgctcaggtccagtgtc
cgccccgtgaagatactcaaggtggcggtttaccctgggaacgtcctgtcgctgcatttc
tccaagccgcaggggtttcggtacaggagtggacagtacatcttcgtcaactgcgccgcc
gtctcgccgttccagtggcacccgttctccatcacgtcggcaccacaggacgactacgtg
agcgtgcacatcaggacgctgggtgactggacacgcgagctcaagaacgtcttctcgagg
gtgtgccggccgccgacggagggcaagagcgggctgctccgcgccgagtacgaccgcgac
ggcagcgccatggccaaccccagcttccccaaggtgctgatcgacggcccctacggcgcg
ccggcgcaggactacaagcagtacgacatcgtgcttctcgtcgggctgggcatcggcgcc
acgcccatgatctccatcatcaaggacatcatcaacaacatgaagcagccggacggcgac
ctggaagccggcgccggcgccgacacgtcggcgtcctccatggcgtcgtcgttccgcacg
cggcgcgcctacttctactgggtgacccgggagcagggctccttcgagtggttccgcggc
gtcatggacgaggtggccgagacggacaagaagggcgtcatcgagctccacaactactgc
accagcgtgtacgaggaaggcgacgcccggtcggcgctcatcgccatgctccagtcgctc
aaccacgccaagcacggcgtcgacgtcgtgtccgggacacgcgtcaagacgcacttcgcc
aggcccaactggcgcaacgtctacaagcgcatcgccctcaaccaccagaaccagcgcgtc
ggagtgttctattgtggtgctccggtgctgacaaaggagctgcgcgagctcgcgcaggat
ttctcgcggaaaaccaacaccaagttcgagttccacaaggagaacttctaa

DBGET integrated database retrieval system