KEGG   Sorghum bicolor (sorghum): SORBI_05g023450Help
Entry
SORBI_05g023450   CDS       T01086                                 

Gene name
SORBIDRAFT_05g023450, Sb05g023450
Definition
hypothetical protein
Orthology
K00799  
glutathione S-transferase [EC:2.5.1.18]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glutathione metabolism
Class
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sbi00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
5
AA seq 252 aa AA seqDB search
MSPIKVYAHRWSQPCRAVIIFCRANKIDFEEVTVDLFKSQNLTPEFRKINPMAQVPAIVD
GRFKLFESHAILRYLATVFPGVADHWYPADLFTRAKIESILDWHHSNLRLGAGTFVYYTA
LAPFLGLRPRPEATKHAEKVLMQSLARIESVWLKGDAKFLLGSRQPSIADLSLVCEIMQL
EALGDDMRNKFLGGHERILAWIDNVKKATSPHFEQAHVFLFEVKAQMQSKAAVAAKLGAS
EASSKHKFASKL
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgtcgccaatcaaggtatacgcccacaggtggtcgcaaccctgccgcgccgtcatcatc
ttctgcagggcgaacaagatcgatttcgaggaggtcacggtggatctgttcaagtctcag
aacctcacccctgaattcagaaagataaacccaatggcacaagtgcctgcaattgtggat
ggaaggtttaaactgtttgaaagtcatgccattttgaggtatcttgcgacggtcttccct
ggagttgcagatcactggtatccagctgacttgtttaccagagccaaaattgagtcaatc
ttggattggcatcactcaaatttgcgtcttggtgcaggaacctttgtatactacactgca
ttggcaccatttcttggccttaggccacgtccagaggctacaaaacatgcagaaaaagtg
ctgatgcaatccctggcaaggattgaatctgtatggctaaaaggtgacgccaagttttta
ctgggtagtcgtcaaccatcaatcgcagatctaagccttgtttgcgagataatgcaattg
gaggctcttggtgatgatatgcggaacaaatttctgggaggtcatgagaggatcctcgct
tggatcgacaacgtgaagaaagccacgagtcctcactttgaacaagcccatgtattcctc
ttcgaagtgaaggcacaaatgcaaagcaaggccgccgtggcagcaaaactgggtgcttcc
gaggcaagctcaaagcacaaattcgcatcgaagctttga

DBGET integrated database retrieval system