KEGG   Sorghum bicolor (sorghum): SORBI_06g000580Help
Entry
SORBI_06g000580   CDS       T01086                                 

Gene name
SORBIDRAFT_06g000580, Sb06g000580
Definition
hypothetical protein
Orthology
K01476  
arginase [EC:3.5.3.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Polyamine biosynthesis, arginine => ornithine => putrescine
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:sbi01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:sbi00330]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 340 aa AA seqDB search
MGGAAAGTKWIHHIQRLSAAKVSTEAVERGQSRVIDASLTLIRERAKLKAELLRALGGVK
ASASLLGVPLGHNSSFLQGPAFAPPRIREAIWCGSTNSSTEEGKELNDPRVLTDVGDVPI
QEIRDCGVEDDRLMHVISESVKTVMEEEPLRPLVLGGDHSISYPVVRAVSEKLGGPVDIL
HLDAHPDIYDCFEGNTYSHASSFARIMEGGYARRLLQVGLRSITKEGREQGKRFGVEQYE
MRTFSKDREKLENLKLGEGVKGVYVSVDVDCLDPAFAPGVSHIEPGGLSFRDVLNILQNL
QGDVVAADVVEFNPQRDTVDGMTAMVAAKLVRELTAKISK
NT seq 1023 nt NT seq  +upstreamnt  +downstreamnt
atgggcggcgcggcggcgggtaccaagtggatccaccacatccagcgcctcagcgcggcg
aaggtgtcgacggaggcggtggagcggggccagagccgcgtcatcgacgcctcactcacc
ctcatccgcgagcgcgcaaagctcaaggcagagttgctgcgtgctctgggtggcgtgaaa
gcttcagcgtcgctcttaggggtccctcttggtcacaactcatcctttttacaaggccct
gcatttgctcctccacgcataagggaggccatttggtgtggaagcacaaactctagcaca
gaggaaggcaaagaattgaatgatcctcgggtgctaactgatgttggagatgtccccatt
caagagatccgtgactgtggcgtcgaagatgacagattgatgcatgtaattagtgagtct
gtcaaaacagtgatggaggaggagcctcttcgaccgttggtgttaggaggcgatcactcg
atatcttatccagtggttagagctgtgtctgaaaagcttggaggacctgttgacattctt
catcttgatgcacatccagatatctatgactgttttgaagggaacacttattcacatgcc
tcttcatttgccagaataatggaaggtggttatgccaggagactgctacaggttggattg
agatcaattaccaaagaagggcgtgagcaagggaagagatttggtgtggaacagtatgag
atgcgaaccttctcaaaggaccgagagaagcttgagaatctgaaacttggggaaggtgta
aagggagtgtatgtctcagttgatgtggactgccttgacccagcgtttgctcccggtgtc
tctcacattgagccaggaggcctctcgttccgcgatgtgctcaacatcctccagaatttg
cagggtgacgttgtcgccgccgatgtggtggagttcaacccacagcgtgacacggtggat
gggatgacagccatggtcgccgcgaaactggtccgggagctcactgctaagatttccaag
tga

DBGET integrated database retrieval system