KEGG   Sorghum bicolor (sorghum): SORBI_06g003090Help
Entry
SORBI_06g003090   CDS       T01086                                 

Gene name
SORBIDRAFT_06g003090, Sb06g003090
Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SORBI_06g003090 (SORBIDRAFT_06g003090)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SORBI_06g003090 (SORBIDRAFT_06g003090)
   00640 Propanoate metabolism
    SORBI_06g003090 (SORBIDRAFT_06g003090)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SORBI_06g003090 (SORBIDRAFT_06g003090)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    SORBI_06g003090 (SORBIDRAFT_06g003090)
Enzymes [BR:sbi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SORBI_06g003090 (SORBIDRAFT_06g003090)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SORBI_06g003090 (SORBIDRAFT_06g003090)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 2326 aa AA seqDB search
MSQLGLAAAASKALPLLPNRQRSPAGTTFSSSALSRPSNRRKSRTRSLRDGGDGVSDVKK
HSQSVRQGLAGIIDLPSEAASEVDISHGSEDPRGPPDSYQMNGIINETHNGRHASVSKVV
EFCAALGGKTPIHSILVANNGMAAAKFMRSVRTWANDTFGSEKAIQLIAMATPEDMRINA
EHIRIADQFVEVPGGTNNNNYANVQLIVEVAERVGVSAVWPGWGHASENPELPDALTAKG
IVFLGPPASSMNALGDKVGSALIAQAAGVPTLAWSGSHVEVPLECCLDAIPEEMYRKACV
TTTEEAVASCQVIGYPAMIKASWGGGGKGIRKVHNDDEVRALFKQVQGEVPGSPIFIMRL
AAQSRHLEVQLLCDQYGNVAALHSRDCSVQRRHQKIIEEGPVTVAPRETVKALEQAARRL
AKAVGYVGAATVEYLYSMETGEYYFLELNPRLQVEHPVTEWIAEVNLPAAQVAVGMGIPL
WQIPEIRRFYGMDYGGGYDIWRKTAALATPFNFDEVDSQWPKGHCVAVRITSEDPDDGFK
PTGGKVKEITFKAKPNVWAYFSVKSGGGIHEFADSQFGHVFAYGLSRSAAITNMALALKE
IQIRGEIHSNVDYTVDLLNASDFRENKIHTGWLDTRIAMRVQAERPPWYISVVGGALYKT
VTTNAATVSDYVSYLTKGQIPPKHISLVNSTVSLNIEGSKYTIETVRTGHGSYRLRMNES
TVEANVQSLCDGGLLMQLDGNSHVIYAEEEAGGTRLQIDGKTCLLQNDHDPSKLLAETPC
KLLRFLVADGAHVDADVPYAEVEVMKMCMPLLSPASGVVHCMMSEGQALQAGDLIARLDL
DDPSAVKRAEPFDGIFPQMALPVAASSQVHKRYAASLNAARMVLAGYEHNINEVVQDLIC
CLDNPELPFLQWDELMSVLATRLPRNLKSELEDKYKEYKLNFYRGKNVDFPSKLLRDIIE
ENLAYGSEKEKATNERLVEPLTNLLKSYEGGRESHAHFIAKSLFEEYLMVEELFSDGIQS
DVIETLRHQHSKDLQKVVDIVLSHQGVRNKAKLVTALMEKLVYPNPVAYRDLLVRFSSLN
HKRYYKLALKASELLEQTKLSELRASIARSLSDLGMHKGDMTIKDSMEDLVSAPLPVEDA
LISLFDYSDATVQQKVIETYISRLYQPHLVKDSIQMKFKEYGAIAFWEFSEGHVDTSNGH
GTILGGKRWGSMVVLKSLESASTAIVAALKDSAQYNSSEGNTMHIALLSAENESNMSGTS
DDQAQHRMEKLTKILKDTNVASDLRAAGLKVISCIVQRDEARMPMRHTFLWLDEKSCYEE
EQILRHVEPPLSALLELDKLKVKGYNEMKYTPSRDRQWHIYTLRNTENPKMLHRVFFRTI
VRQPNAGNKFTSAQVSDTEVGGPEDSLSFTSNSILRSLMTAIEELELHAIRTGHSHMYLC
ILKEQKLLDLIPFSGSTIVDVGQDEATACSLLKSMALKIHDLVGARMHHLSVCQWEVKLK
LDCDGPASGTWRVVTTNVTSHTCTIDIYREVEDTESQKLVYHSTTSAAGPGPLHGVALNN
PYQPLSVIDLKRCSARNNRTTYCYDFPLAFETALQKSWQSNGSSVSVGSGNSKSYVKATE
LVFAEKHGSWGTPIVPMERPAGLNDIGMVAWILEMSTPEFPNGRQIIVVANDITFRAGSF
GPREDAFFEAVTNLACERKLPLIYLAANSGARIGIADEVKSCFRVGWSDEGSPERGFQYI
YLTEEDYARISSSVIAHKLQLDSGEIRWIIDSVVGKEDGLGVENIHGSAAIASAYSRAYE
ETFTLTFVTGRTVGIGAYLARLGIRCIQRLDQPIILTGFSALNKLLGREVYSSHMQLGGP
KIMATNGVVHLTVPDDLEGVSNILRWLSYVPANIGGPLPITKPLDPPDRPVAYIPENTCD
PRAAIRGVDDSQGKWLGGMFDKDSFVETFEGWAKTVVTGRAKLGGIPVGVIAVETQTMMQ
LVPADPGQLDSHERSVPRAGQVWFPDSATKTAQALLDFNREGLPLFILANWRGFSGGQRD
LFEGILQAGSTIVENLRTYNQPAFVYIPMAGELRGGAWVVVDSKINPDRIECYAERTAKG
NVLEPQGLIEIKFRSEELQDCMGRLDPELINLKAKLQDVKHGNGSLPDIESLQKSIEART
KQLLPLYTQIAIRFAELHDTSLRMAAKGVIKKVVDWEESRSFFYKRLRRRISEDVLAKEI
RHIVGDNFTHQSAMELIKEWYLASPATAGSTGWDDDDAFVAWKDSPENYNGYIQELRAQK
VSQSLSDLTDSSSDLQAFSQGLSTLLDKMDPSQRAKFVQEVKKVLG
NT seq 6981 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcagcttggattagctgcagctgcctcaaaggcactgccactactccctaatcgc
cagcgaagtcctgctgggactacattctcatcatctgcattgtcgaggccctcaaaccga
aggaaaagccgtacccgttcactccgtgatggtggagatggggtatcagatgtcaaaaag
cacagccagtctgttcgtcaaggtcttgctggcattattgacctcccaagcgaggcagct
tcggaagtggacatttcacatggatctgaggatcctaggggtccaccagattcctatcaa
atgaatgggattatcaatgaaacacataatggaagacatgcttcagtgtccaaggttgtt
gaattttgtgcggcactaggtggcaaaacaccaattcacagtatattagtggccaataat
ggaatggcagcagcaaagttcatgaggagtgtccggacatgggctaatgatacttttgga
tctgagaaggcaattcagctcatagctatggcaactccggaagacatgaggataaatgca
gagcacattagaattgctgatcaatttgtagaggtgcctggtggaacaaacaataataac
tacgccaacgttcaactcatagtggaggtagcagaaagagtaggtgtttctgctgtttgg
cctggttggggtcatgcttctgagaatcctgaactgccggatgcattgactgcaaaagga
atcgttttccttgggccacctgcatcatcaatgaatgcattgggagataaggtcggttca
gctctcattgctcaagcagctggggtcccaactcttgcttggagtggatcacatgttgaa
gtgccattagagtgctgcttagacgctatacctgaggagatgtatagaaaagcttgtgtt
actaccacagaggaagcagttgcaagttgtcaagtgattggttatcctgccatgattaag
gcatcctggggaggtggtggtaaaggaataagaaaggttcataatgatgatgaggttaga
gcactgtttaagcaagtacaaggtgaagtccctggctccccaatatttatcatgaggctt
gcagcccagagtcggcatcttgaagttcagttgctttgtgatcaatatggcaatgtagca
gcacttcacagtcgtgattgcagtgtgcaacggcgacaccagaagattattgaagaaggc
ccagttactgttgctcctcgtgagacagttaaagcacttgagcaggcagcaaggaggctt
gctaaggctgtgggttatgttggtgctgctactgttgagtatctttacagcatggaaact
ggagaatactattttctggagcttaatccccgactacaggtcgagcatccagtcaccgaa
tggatagctgaagtaaatctgcctgcagctcaagttgctgttggaatgggcatacctctt
tggcaaattccagaaatcagacgtttctatggaatggactatggaggagggtatgatatt
tggaggaaaacagcagctcttgctacaccatttaattttgatgaagtagattctcaatgg
ccaaagggccattgtgtagcagttagaattactagtgaggaccctgatgatggtttcaaa
cctactggtgggaaagtgaaggagataacttttaaagccaagcctaatgtttgggcctac
ttctcagtaaagtctggtggaggcattcatgaatttgctgattctcagtttggacatgtt
tttgcatatggactctctagatcagcagcaataacaaacatggctcttgcattaaaagag
attcaaattcgtggagaaattcattcaaatgttgattacactgttgacctcttaaacgct
tcagacttcagagaaaacaagattcatactggttggctggataccagaatagctatgcgt
gttcaagctgagaggcccccatggtatatttcagtggttggaggtgctttatacaaaaca
gtaaccaccaatgcagccactgtttctgactatgttagttatctcaccaagggccagatt
ccaccaaagcatatatcccttgtcaattctacagttagcttgaatatagaagggagcaaa
tacacaattgaaactgtaaggactggacatggtagctacaggttgcgaatgaatgaatcg
acagttgaagcgaatgtacaatctttatgtgatggtggactcttaatgcagttggatgga
aacagccatgtaatttatgcagaagaagaagctggtggtacacggcttcagattgatgga
aagacatgcttgttgcagaatgaccatgatccatcaaagttattagctgagacaccctgc
aaacttcttcgtttcttggttgctgatggtgctcatgttgatgcggatgtaccatacgct
gaagttgaggttatgaagatgtgcatgcctctcctgtcacctgcttctggtgtcgttcat
tgtatgatgtctgagggccaggcgttgcaggctggtgatcttatagcaaggctggatctt
gatgacccttctgctgtgaaaagggctgaaccatttgatggaatatttccacaaatggcg
ctccctgttgctgcctctagtcaagtacacaaaagatatgctgcaagtttgaatgctgct
cgaatggttcttgcaggatatgagcacaatatcaatgaagtcgttcaagatttgatatgc
tgcctggacaaccctgagcttcctttcctacagtgggatgaacttatgtctgttctagca
acgaggcttccaagaaatctcaagagtgagttagaggataaatacaaggaatacaagttg
aatttttaccgtggaaaaaacgtggacttcccttccaagttgctaagagacatcattgag
gaaaatcttgcatatggttcagagaaggaaaaggctacaaatgagaggcttgttgagcct
cttacgaacctactgaagtcatatgagggtgggagagaaagtcatgcacattttattgcc
aagtcccttttcgaggagtatcttatggtggaagaacttttcagtgatggaattcagtct
gacgttattgaaaccttgcgtcatcagcacagtaaagacctgcagaaggttgtagacatt
gtgttgtctcaccagggtgtgagaaacaaagctaagcttgtaacagcactcatggaaaag
ctggtttatccaaatccggttgcttacagggatctgttggttcgcttttcttccctcaat
cataaaagatattataagttggcccttaaagcaagtgaacttcttgaacaaaccaaacta
agtgaactccgtgcaagcattgcaagaagcctttcagatctggggatgcataagggagac
atgactattaaggatagcatggaagatttagtctctgccccattgcctgttgaagatgct
cttatttctttgtttgattacagcgatgcaactgttcagcagaaagtgattgagacatac
atatcacgattgtaccagcctcatcttgtgaaggatagcatccaaatgaaattcaaggaa
tatggtgctattgctttttgggaattttctgaagggcatgttgatacttcaaatggacat
gggactattcttggtgggaagagatggggttccatggtcgtcctcaaatcacttgaatct
gcatcaacagccattgtggctgcattaaaggattcagcacagtacaacagctctgagggc
aacacgatgcacattgcattattgagtgctgaaaatgaaagtaatatgagtggaacaagt
gatgatcaagctcaacataggatggaaaagcttaccaagatactgaaggatactaatgtt
gcaagtgatctccgagctgctggtttgaaggttataagttgcattgttcaaagagatgaa
gctcgcatgccaatgcgccacacattcctctggttggatgaaaagagttgttatgaagaa
gagcaaattctccggcatgtggagcctcccctctctgcacttcttgaattggataagttg
aaagtgaaaggatacaatgaaatgaagtatactccgtcacgtgatcgtcaatggcatatc
tacacactaagaaatactgaaaaccccaaaatgttgcatagggtatttttccgaactatt
gtcaggcaacccaatgcaggcaacaagtttacatcagctcaggtcagtgatactgaagta
ggaggtcctgaagattctctgtcattcacatcgaatagcatcctaagatcattgatgact
gctatagaagaattagagcttcatgcgattaggacaggtcattctcacatgtatttgtgc
atactgaaagagcaaaagcttcttgatctcattccattttcagggagtacaattgttgat
gttggccaagatgaagctactgcttgttcacttttaaaatcaatggctttgaagatacat
gaccttgttggtgcaaggatgcatcatctgtctgtatgccagtgggaggtgaaactcaag
ttggattgtgatgggcctgcaagtggtacctggagagttgtgactacaaatgttactagt
cacacctgcaccattgatatctaccgagaagtggaagatacagaatcgcagaagttagta
taccattcaaccacttcggcagctggtcctggtccgttgcatggtgttgcactgaataat
ccatatcaacctttaagtgtgattgatctaaagcgctgctctgctaggaacaacagaaca
acatattgctacgattttccgctggcatttgaaactgcactgcagaagtcatggcagtcc
aacggctctagtgtttctgtaggcagtggaaatagtaaatcctacgtgaaggcaactgag
ctggtgtttgctgaaaaacatgggtcctggggcactcctatagttcccatggaacgtcct
gctgggctcaatgacattggtatggtcgcttggatcttggagatgtcaacacctgaattt
cccaatggcaggcagattattgttgtagcaaatgatattactttcagagctggatcattc
ggcccaagggaagatgcattttttgaagctgtcaccaacctggcttgtgaaaggaaactt
ccccttatatacttggcagcaaactctggtgctaggattggcatagctgatgaagtaaaa
tcttgcttccgtgttgggtggtctgacgaaggcagccctgagcgagggtttcagtacatc
tatctgactgaagaagactatgcccgtattagctcttctgttatagcacataagctgcag
ctagatagcggtgaaattaggtggattattgactctgttgtgggcaaggaggatgggctt
ggtgttgagaacatacatggaagtgctgctatcgccagtgcttattctagggcatatgag
gagacatttacacttacatttgtgaccggacggactgtaggaataggagcttatcttgct
agacttggtatacggtgcatacagcgtcttgaccagccgattattttaacagggttttct
gccctgaacaagctccttgggcgggaagtgtacagctcccacatgcagcttggtggtcct
aagatcatggcgaccaatggtgttgtccacctgactgttccagatgaccttgaaggtgtt
tccaatatattgaggtggctcagctatgttcctgcaaacattggtggacctcttcctatt
accaaacctttggaccctccagacagacctgttgcatacatccctgagaacacatgcgat
ccacgtgcagccatccgtggtgtagatgacagccaagggaaatggttgggtggtatgttt
gacaaagacagctttgtggagacatttgaaggatgggcaaaaacagtggttactggcaga
gcaaagcttggaggaattcctgtgggtgtcatagctgtggagacacagaccatgatgcag
cttgtccctgctgatccaggtcagcttgattcccatgagcgatccgttcctcgggctgga
caagtgtggttcccagattctgcaaccaagacagctcaggcattattagacttcaaccgt
gaaggattgcctctgtttatcctggctaactggagaggtttctctggtggacagagagat
ctctttgaaggaattcttcaggctgggtcaacaattgtcgagaaccttaggacatataat
cagcctgcgtttgtctacattcctatggctggagagcttcgtggaggagcttgggttgtg
gtcgatagcaaaataaatccagaccgcattgagtgttatgctgagaggactgccaaaggt
aatgttctcgaacctcaagggttaattgaaatcaagttcaggtcagaggaactccaagac
tgtatgggtaggcttgaccccgagttgataaatctgaaagcaaaactccaagatgtaaag
catggaaatggaagtctaccagacatagaatcccttcagaagagtatagaagcacgtacg
aaacagttgctgcctttatatacccagattgcaatacggtttgctgaattgcatgatact
tccctaagaatggcagctaaaggcgtgattaagaaagttgtagactgggaagaatcacgc
tctttcttctataaaaggctacggagaaggatctctgaagatgttcttgcaaaagaaata
agacatatagtcggtgacaacttcactcaccaatcagcaatggagctcatcaaggaatgg
tacctggcttctccagccacagcaggaagcactggatgggatgacgatgatgcatttgtt
gcctggaaggacagtcctgaaaactacaatggatatatccaagagctaagggctcaaaaa
gtgtctcagtcgctctctgatctcactgactccagttcagatctacaagcattctcgcag
ggtctttctacgctattagataagatggatccctctcaaagagcgaagtttgttcaggaa
gtcaagaaggtccttggttga

DBGET integrated database retrieval system