KEGG   Sorghum bicolor (sorghum): SORBI_06g015180Help
Entry
SORBI_06g015180   CDS       T01086                                 

Gene name
SORBIDRAFT_06g015180, Sb06g015180
Definition
hypothetical protein
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SORBI_06g015180 (SORBIDRAFT_06g015180)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SORBI_06g015180 (SORBIDRAFT_06g015180)
   00620 Pyruvate metabolism
    SORBI_06g015180 (SORBIDRAFT_06g015180)
   00640 Propanoate metabolism
    SORBI_06g015180 (SORBIDRAFT_06g015180)
Enzymes [BR:sbi01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     SORBI_06g015180 (SORBIDRAFT_06g015180)
Lipid biosynthesis proteins [BR:sbi01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   SORBI_06g015180 (SORBIDRAFT_06g015180)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 692 aa AA seqDB search
MGASDHLAAAAAAAKPRNGRPCAAVLGEPLPALDDPGLLVHPSADFAAQALVSSTQQYRE
MYQKSIDDPAGFWSEIADEFYWKQKWSPDEVCAENLDVTKGPIKIEWFKGGKTNICYNAV
DRHVEAGNGDKIAMYWEGNEPSQDGKLTYSELLEKVCQLSNYLKSVGVGKGDAVVIYLPM
LMELPIAMLACARIGAVHSVVFAGFSAEALAQRVIDCKPKVVITCNAVKRGLKIIFLKDI
VDASLDESAKNGVDVGICLTYENQSALNKVDTRWTTGRDVWWQDVVPDFPTKCDVEWVDA
EDPLFLLYTSGSTGKPKGVLHTTGGYMVYSATTFKHAFDYKPTDIYWCTADCGWITGHSY
VTYGPLLNGATVLVFEGAPNYPDPGRCWDIVDKYGVTIFYTAPTLIRSLMRDGTEYVARY
SRKSLRVLGSVGEPINPTAWRWFYDVIGDSRCPISDTWWQTETGGFMITPLPGAWPQKPG
SATFPFFGVQPVIVDEKGREMEGECSGYLCIKKSWPGAFRTLYGDKERYETTYFKPFAGY
YFSGDGCSRDKDGYHWLTGRVDDVINVSGHRIGTAEVESALVSHPKCAEAAVVGIDHEVK
GQGIYAFVTLVDGVPYSDDLRKSLVMTVRSQIGAFAAPDKIHWAPGLPKTRSGKIMRRIL
RKIASRQLDELGDTSTLADPGVVDQLIVLSDS
NT seq 2079 nt NT seq  +upstreamnt  +downstreamnt
atgggcgcgagcgatcacctggcggcggcggcggccgccgccaagccgcggaacggcagg
ccgtgcgcggccgtgctgggcgagccgctgccggcgctcgacgaccccggcctcctcgtc
caccccagcgccgacttcgccgcccaggcgctcgtctcctccacacagcagtaccgggag
atgtatcaaaagtcgatcgacgacccagctgggttctggtcggagatcgcggatgagttc
tactggaagcagaagtggagccctgatgaagtttgtgcggagaacctcgacgtgaccaag
gggccgatcaagattgaatggttcaaggggggaaagaccaacatatgctacaatgcggtg
gaccgccatgtggaggctgggaatggggacaagattgccatgtactgggaggggaatgag
cccagtcaggatgggaagctcacctactctgagctcctggaaaaggtttgccagctgtcg
aattacttgaaaagcgtcggcgttggaaagggtgatgccgtggtgatctacctaccaatg
ttgatggagctgccgattgcaatgcttgcatgtgcccgcattggtgctgttcactcggtt
gtgtttgctggcttctcagccgaggcactggcccaacgagttattgattgcaagcctaag
gttgttattacctgcaatgctgtgaaaagggggttgaaaatcatctttctcaaagatata
gtagatgcatctctggatgaaagtgcaaagaatggagttgatgtaggcatttgcttgaca
tacgaaaaccagtccgcgctgaataaagtagacacgcgatggacaacaggaagagatgtt
tggtggcaggatgttgtgcccgatttcccaactaaatgtgatgtggaatgggttgatgca
gaggatccactgtttcttttgtacacaagtggcagcacaggaaagccaaagggtgtgttg
catacaactgggggctatatggtctactctgctacaacatttaagcatgcatttgactac
aagccaacagacatatactggtgcactgcagattgtggctggattactggacatagttat
gtgacatatggtccactattgaatggagccacagttcttgtttttgaaggggctccaaat
taccctgatcctggtcgctgttgggacatcgttgataaatatggagtgacaatattttat
actgcaccaacacttatacgctcgcttatgcgtgatggtactgagtatgttgctcggtac
tctcgcaagtccctccgagtgcttggaagtgtgggtgagccaatcaaccccaccgcatgg
aggtggttctatgatgttattggcgactcacgatgccctatatcagatacttggtggcag
actgaaactgggggattcatgataactccattacctggtgcttggcctcaaaagccagga
tcagcaacatttcctttcttcggtgtgcagccagtcattgttgacgagaaaggtcgggaa
atggaaggagaatgcagtgggtatctttgcataaagaaatcgtggcctggggctttccgg
actctatatggagataaagagagatatgagacgacatacttcaaaccatttgctggatat
tatttctcgggtgatggctgcagcagggataaagatggttaccactggctgactggaaga
gttgatgatgttatcaatgtgagtggacaccggattgggacagccgaagttgagtctgct
ctggtttcacatccaaaatgtgccgaggccgctgttgttggtattgatcacgaggttaaa
ggtcagggaatatatgctttcgtgactttggtagatggtgttccctacagtgacgatcta
cggaaaagcctcgttatgacggtccgcagtcagattggcgcgtttgctgctcctgacaag
atccactgggcacctgggctcccaaagacgcgaagtgggaagatcatgcgaagaatctta
cgaaaaatcgcatccaggcaactagatgagctcggagacacgagcacgcttgctgacccc
ggtgttgtggaccagctgattgtgctcagtgacagctaa

DBGET integrated database retrieval system