KEGG   Sorghum bicolor (sorghum): SORBI_06g015360Help
Entry
SORBI_06g015360   CDS       T01086                                 

Gene name
SORBIDRAFT_06g015360, Sb06g015360
Definition
hypothetical protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Trehalose biosynthesis, D-glucose 1P => trehalose
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SORBI_06g015360 (SORBIDRAFT_06g015360)
Enzymes [BR:sbi01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     SORBI_06g015360 (SORBIDRAFT_06g015360)
Exosome [BR:sbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SORBI_06g015360 (SORBIDRAFT_06g015360)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 827 aa AA seqDB search
MASFAVSGAGARLGVVRPGGSARSGGGERRSGVDLPSVLFRRKDAISRTVLSCAGAPGKV
LVPGGGSDDVLSSAEPVVDTSEQHEELQIPDAEQVVEEKAYSSAAQATSAAAEESSEVDA
AIKAKAPLVEEKPRVISPPGDGQRIYEIDPMLEGYRGHLDYRYSEYKRMRAAIDQHEGGL
DAFSRGYEKLGFTRSAEGITYREWAPGASSAALVGDFNNWNPNADAMTRNEYGVWEIFLP
NNADGSPAIPHGSRVKIRMDTPSGVKDSIPAWIKFSVQAPGEIPYNGIYYDPPEEEKYVF
KHPQPKRPKSLRIYESHIGMSSPEPKINTYANFRDEVLPRIKRLGYNAVQIMAIQEHSYY
ASFGYHVTNFFAPSSRFGTPEDLKSLIDKAHELGLLVLMDIVHSHSSNNTLDGLNGFDGT
DTHYFHGGPRGHHWMWDSRLFNYGSWEVLRYLLSNARWWLEEYKFDGFRFDGVTSMMYTH
HGLQVAFTGNYGEYFGFATDVDAVVYLMLVNDLIHGLYPEAVSIGEDVSGMPTFCIPVQD
GGVGFDYRLHMAVPDKWIELLKQSDEYWKMGDIVHTLTNRRWLEKCVTYCESHDQALVGD
KTIAFWLMDKDMYDFMALDRPSTPVIDRGIALHKMIRLITMGLGGEGYLNFMGNEFGHPE
WIDFPRGPQSLPNGSVIPGNNYSFDKCRRRFDLGDADYLRYRGMQEFDQAMQHLEGKYEF
MTSDHSYVSRKHEEDKVIIFERGDLVFVFNFHWSNSYFDYRVGCFKPGKYKIVLDSDDGL
FGGFSRLDHDAEYFTADWPHDNRPCSFSVYAPSRTAVVYAPAGEEDE
NT seq 2484 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgttcgctgtgtccggcgcgggcgcgaggctcggggtcgtgcggcccggcggc
tcggcgcgatctggcggcggggagcggaggagtggggtggacttgccgtcggtgctcttc
aggaggaaggacgccatctctcgtaccgttctgagctgcgctggtgctcctggaaaggtg
ctggtgcctggaggtggcagtgatgacgtgctttcctccgcagagcctgtcgtggacact
tcagagcagcacgaagaactacagatacctgatgcagaacaggttgtggaggagaaagca
tactcatcagcagctcaagcaacctcagcagcggctgaagaaagctcagaagttgacgca
gccatcaaagccaaagcaccactcgtggaggagaaaccacgagttatctccccaccagga
gatggtcagcgaatatatgagattgacccaatgctggaagggtatcggggccaccttgac
taccgatacagtgaatataagagaatgcgtgcggctattgatcaacatgaaggtggcttg
gatgcattttcacgcggttacgaaaagcttggatttactcgcagcgctgaaggtatcact
tatagagaatgggctcctggagcatcctctgcagcattagtaggtgacttcaacaactgg
aatccaaatgctgatgctatgaccagaaatgagtatggcgtttgggagattttcctgcct
aataacgctgatggttcccctgctattcctcatggctcacgtgtaaagatacggatggat
acaccatctggtgtgaaggattccattcctgcgtggatcaagttttctgtacaagctcca
ggtgaaataccatacaatggtatatattatgatccacctgaagaggagaaatatgtattc
aaacaccctcaacctaagcggccaaagtcactgcggatatacgaatcacatattggaatg
agtagtccggaaccaaagataaatacgtatgctaacttccgagatgaggtgctgccaaga
attaaaaggcttggatacaatgcagtacagataatggcaatccaggaacactcttattat
gcaagctttgggtaccatgttacgaacttttttgcgccaagtagccgttttgggactcct
gaggacctaaaatctctgattgacaaagcgcatgagcttggcttgctagtgctcatggat
attgttcatagtcattcatcaaataataccttggacggtttgaatggtttcgatggcact
gatacacattacttccatggtggtccacggggccatcattggatgtgggattctcgccta
ttcaattatgggagttgggaagttttgagatatctactgtcaaatgcaagatggtggctt
gaagaatataagtttgatggatttcgatttgatggggtgacctccatgatgtatactcac
catggattacaagtggcattcaccgggaactatggcgagtattttggatttgctactgat
gttgatgcagtagtttacctaatgctggtaaacgatcttattcatgggctttatccagaa
gctgtatccattggtgaagatgtcagcggaatgcctacgttttgtattcctgtccaagat
ggtggtgttggttttgattatcgccttcatatggctgtcccagacaaatggattgaactt
ctgaagcaaagtgatgaatattggaaaatgggtgatatcgtgcacaccttaacaaataga
aggtggctagaaaagtgtgtcacttattgtgaaagtcatgatcaagctttagttggtgac
aagacaattgcattctggttgatggacaaggatatgtatgatttcatggctctggacagg
ccttcaacacctgtcatcgatcgtgggatagcattacataaaatgattaggcttatcaca
atgggtttaggaggtgaaggctatctaaatttcatgggaaatgagtttgggcatcctgaa
tggatagattttccaagaggtcctcaaagtcttccaaatggctctgtcattcctgggaat
aactatagctttgataaatgccgtcgtagatttgaccttggagatgcagattatctgaga
tatcgtggcatgcaagagtttgatcaggcaatgcagcaccttgagggaaaatatgaattc
atgacatctgatcactcatatgtatcacggaaacatgaggaggataaggtgatcatcttc
gagagaggagatttggtctttgtattcaacttccactggagcaatagctattttgactat
cgtgttggttgtttcaagcctgggaagtacaagatcgtgttagattctgacgatggcctt
ttcggtggatttagtcggcttgatcatgatgctgagtacttcactgctgactggccgcat
gacaacaggccgtgttctttctcggtctatgcacccagcagaacagccgtcgtatatgca
cctgcaggtgaagaggacgaatag

DBGET integrated database retrieval system