KEGG   Sorghum bicolor (sorghum): SORBI_06g017160Help
Entry
SORBI_06g017160   CDS       T01086                                 

Gene name
SORBIDRAFT_06g017160, Sb06g017160
Definition
hypothetical protein
Orthology
K09580  
protein disulfide-isomerase A1 [EC:5.3.4.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SORBI_06g017160 (SORBIDRAFT_06g017160)
Enzymes [BR:sbi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SORBI_06g017160 (SORBIDRAFT_06g017160)
Exosome [BR:sbi04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   SORBI_06g017160 (SORBIDRAFT_06g017160)
  Exosomal proteins of colorectal cancer cells
   SORBI_06g017160 (SORBIDRAFT_06g017160)
  Exosomal proteins of bladder cancer cells
   SORBI_06g017160 (SORBIDRAFT_06g017160)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 479 aa AA seqDB search
MAVSLVLPFTILLAAVLLSGPVLAEVETAVELGEVVLTLDASNFSEVVAKHQFIVVEFYA
PWCGHCKQLAPEYEKAAAVLRNHDPPLVLAKVDAYDERNKEIKDKYQVHAYPTIKIIENG
GKDVRGYGGPRDADGIVGYLKKQVGPASIELSSAEAAQSSIGDKGVVLVGVFPEFAGVEY
ENFMAVAEKKRSDYDFFHTSDASILPRGDQTIKGPVVRLFKPFDELFADSRDFDTDALEK
FIDVSGFPAVVTFDADPTNHKFLERYYSTPSAKAMLFLNFSDDRVEAFKNQIQEAAKKFS
ANNISFLIGDVEAADRAFQYGNLTPYVKSEPIPKVNDQPVKVVVADSIDDVVFNSGKNVL
LEFYAPWCGHCRKLAPILEEVAVSLQDDEDVVIAKMDGTANDIPTDLAVEGYPTIYFYST
TGDLYSYNGGRTAEDIISFIKKNKGPRAGAVDEVTQTDAGAVEEGTAPSSTSELPKDEL
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atggctgtctccctggtgcttccgttcaccatcctcctcgctgccgttctcctctctggt
cctgtcttggctgaggtggagaccgccgtggagctgggcgaggtggtcctgacgcttgac
gccagtaacttctcggaggtggtggccaagcaccagttcatcgtcgtcgagttctacgcg
ccatggtgtggccactgcaagcaactcgctccagagtacgagaaggcagctgctgttctg
aggaatcacgacccgccgttggtgctcgccaaagtggacgcgtacgacgagaggaacaag
gagatcaaggacaagtaccaggtgcatgcgtaccccaccatcaagatcatagagaacgga
gggaaggatgtacgtggctatggtggtccgagggacgccgatggcattgtggggtacctc
aagaagcaggtcggcccagcttccatcgagctcagttcggcggaggctgctcagtcgtcc
atcggtgacaagggggtggttcttgttggagttttccccgagtttgctggcgtggagtat
gagaatttcatggccgtggcagagaaaaaacggtcagactatgatttctttcacacgtca
gacgcaagcattctgccacgtggtgatcagactatcaagggccctgttgttcgtctcttc
aaaccatttgacgagctctttgctgattcacgggattttgatacggatgctcttgaaaaa
ttcattgacgtgtctggtttcccagcagtagttacattcgatgctgatccaaccaaccat
aagtttcttgagagatactacagcactcctagtgccaaagcaatgcttttcttgaacttc
agtgacgacagagtggaggccttcaagaatcagattcaagaagctgccaagaaattcagt
gctaataacataagttttctaattggtgatgttgaagctgctgaccgtgccttccagtat
ggaaacttgacaccttatgttaagtcagagccaatcccaaaggtgaatgaccaacctgtt
aaggtcgttgtggctgacagtatcgatgatgtcgttttcaactctggcaaaaatgtactg
ctcgagttctatgcaccttggtgtggccattgccggaagctggccccaatcttggaggaa
gttgcagtctcattacaagacgacgaagacgtcgtcattgcaaagatggatggcactgca
aacgatatccctaccgacttggcggtggagggatatcccacgatctacttctactcgacc
accggtgacctttattcctacaatggtggaagaacggccgaggacatcatcagtttcatc
aagaagaacaagggccccagagctggtgccgtggacgaagtgacgcagacggatgctggt
gctgtagaagagggcactgcaccttcatcgacgtcagagcttccgaaagacgaactctga

DBGET integrated database retrieval system