KEGG   Sorghum bicolor (sorghum): SORBI_06g020720Help
Entry
SORBI_06g020720   CDS       T01086                                 

Gene name
SORBIDRAFT_06g020720, Sb06g020720
Definition
hypothetical protein
Orthology
K01638  
malate synthase [EC:2.3.3.9]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Pyruvate metabolism
Glyoxylate and dicarboxylate metabolism
Metabolic pathways
Carbon metabolism
Module
Glyoxylate cycle
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SORBI_06g020720 (SORBIDRAFT_06g020720)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SORBI_06g020720 (SORBIDRAFT_06g020720)
   00630 Glyoxylate and dicarboxylate metabolism
    SORBI_06g020720 (SORBIDRAFT_06g020720)
Enzymes [BR:sbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.3  Acyl groups converted into alkyl groups on transfer
    2.3.3.9  malate synthase
     SORBI_06g020720 (SORBIDRAFT_06g020720)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 569 aa AA seqDB search
MAASTTAAPAPCYDAPEGVDVRGRYDREFASILTRDALGFVAGLQREFRGAVRYAMEQRR
EAQRRYDAGELPRFDPATRLVRDGDWTCAPVPPAVADRTVEITGPAEPRKMVINALNSGA
KVFMADFEDALSPTWENLMHGQVNLRDAVAGTITYRDAARGREYKLNDRTAKLFVRPRGW
HLPEAHILVDGEPAIGCLVDFGLYFFHNHAAFRAGQGAGFGPFFYLPKMEHSREARIWNG
VFQRAEKAAGIEPGSIRATVLVETLPAVFQMNEVLHELREHSAGLNCGRWDYIFSYVKTF
RAHPDRLLPDRALVGMAQHFMRSYSHLLIHTCHRRGVHAMGGMAAQIPIKDDAAANEAAL
ELVRKDKLREVRAGHDGTWAAHPGLIPAVREVFEGHLGGRPNQIIIGDGAAAGGHEHEGA
SVREEDLIQPPRGARTVDALRLNVRVGVQYLAAWLGGSGSVPLYNLMEDAATAEISRVQN
WQWLHHGAALDAGGVEVRATPDLLARVVEEEMARVEAEVGHERFRKGRYEEAGRIFSRQC
TAPELDDFLTLDAYNLIVAHHPGASPCKL
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggctgcgagcaccaccgcggcgccggcgccatgctacgacgcgccggagggcgtggac
gtccgcgggcggtacgaccgggagttcgcgtcgatcctcacccgcgacgcgctggggttc
gtggccggcctgcaacgcgagttccgcggcgccgtccgctacgccatggagcagcggcgg
gaggcccagcggcggtacgacgccggcgagctgccgcggttcgacccggccacgaggctc
gtgcgcgacggggactggacgtgcgcgcccgtgccgccggccgtcgccgaccgcaccgtc
gagatcacgggccccgccgagccgcggaagatggtcatcaacgcgctcaactccggcgcc
aaggtcttcatggctgacttcgaggacgcgctgtcgccgacgtgggagaacctgatgcac
gggcaggtgaacctgcgggacgccgtggctggcaccatcacctaccgcgacgcggcgcgc
gggcgggagtacaagctcaacgaccgaaccgccaagctcttcgtccgcccccgcggctgg
cacctccccgaggcgcacatcctcgtcgacggcgagccggccatcggctgcctcgtcgac
ttcggcctctacttcttccacaaccacgccgccttccgcgccggccagggcgccggcttc
ggcccattcttttacctccccaagatggagcactccagggaagcgaggatatggaacggg
gtgttccagagagcggagaaagctgctgggatcgagccggggagcatccgggcgacggtg
ctggtggagacgctgccggcggtcttccagatgaacgaggtcctgcacgagctgcgcgag
cactcggcggggctcaactgcggccgctgggactacatcttcagctacgtcaagacgttc
cgcgcccacccggaccgcctcctccccgaccgcgccctcgtcggcatggcccagcacttc
atgcgctcctactcccacctcctcatccacacctgccaccgccgcggcgtccacgccatg
ggcggcatggcggctcagattccgatcaaggacgacgcggcggcgaacgaggcggcgctg
gagctggtgcgcaaggacaagctgagggaggtgcgcgcggggcacgacggcacgtgggcg
gcgcacccggggctcatcccggcggtccgggaggtcttcgagggccacctcggcgggagg
ccgaaccagatcatcatcggcgacggcgccgccgccggggggcacgagcacgagggcgcc
agcgtcagagaggaggacctcatccagccgccgcggggcgcgcgcacggtggacgcactg
cggctcaacgtccgcgtgggcgtgcagtacctcgcggcgtggctgggcggctcgggctcc
gtcccgctgtacaacctgatggaggacgcggccacggcggagatcagccgcgtccagaac
tggcagtggctgcaccacggcgcggcgctggacgccggcggcgtggaggtgcgcgcgacg
ccggacctgctcgcgcgcgtcgtcgaggaggagatggcgagggtcgaggcggaggtcggc
cacgagaggttccggaaggggcggtacgaggaggcaggcaggatcttcagccggcagtgc
accgcgccggagctggacgacttcctcacgctcgacgcgtacaacctcatcgtggcgcac
catccaggtgcttcaccgtgcaagctctga

DBGET integrated database retrieval system