KEGG   Sorghum bicolor (sorghum): SORBI_06g020950Help
Entry
SORBI_06g020950   CDS       T01086                                 

Gene name
SORBIDRAFT_06g020950, Sb06g020950
Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SORBI_06g020950 (SORBIDRAFT_06g020950)
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.3  With oxygen as acceptor
    1.3.3.4  protoporphyrinogen oxidase
     SORBI_06g020950 (SORBIDRAFT_06g020950)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 544 aa AA seqDB search
MLARTATVSSTSSHSHPYRPTSARSLRLRPVLAMAGSDDSRAAPARSVAVVGAGVSGLVA
AYRLRKSGVNVTVFEAADRAGGKIRTNSEGGFLWDEGANTMTEGELEASRLIDDLGLQDK
QQYPNSQHKRYIVKDGAPALIPSDPISLMKSSVLSTKSKIALFFEPFLYKKANTRNPGKV
SDEHLSESVGSFFERHFGREVVDYLIDPFVAGTSAGDPESLSICHAFPALWNLERKYGSV
VVGAILSKLTAKGDPVKTRRDSSAKRRNRRVSFSFHGGMQSLINALHNEVGDDNVKLGTE
VLSLACTLDGAPAPGGWSISDDSKDASGKDLAKNQTFDAVIMTAPLSNVQRMKFTKGGAP
FVLDFLPKVDYLPLSLMVTAFKKEDVKKPLEGFGVLIPYKEQQKHGLKTLGTLFSSMMFP
DRAPDDQYLYTTFVGGSHNRDLAGAPTSILKQLVTSDLKKLLGVQGQPTFVKHIYWGNAF
PLYGHDYNSVLEAIEKMEKNLPGFFYAGNNKDGLAVGSVIASGSKAADLAISYLESHTKH
NNLH
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctcggactgccacggtctcctccacttcgtcccactcccatccttatcgcccc
acctccgctcgcagtctccgcctacgtccggtcctcgcgatggcgggctccgacgactcc
cgcgcagctcccgccaggtcggtcgccgtcgtcggcgccggggtcagcgggctcgtggcg
gcgtacaggctcaggaagagcggcgtgaatgtgacggtgttcgaggcggccgacagggcg
ggaggaaagatacggaccaattccgagggcgggtttctctgggatgaaggagcgaacacc
atgacagaaggtgaattggaggccagtagactgatagatgatctcggtctacaagacaaa
cagcagtatcctaactcccaacacaagcgttacattgtcaaagatggagcaccagcactg
attccttcggatcccatttcgctgatgaaaagcagtgttctttctacaaaatcaaagatt
gcgttattttttgaaccatttctctacaagaaagctaacacaagaaaccctggaaaagta
tctgatgagcatttgagtgagagtgttgggagcttctttgaacgccacttcggaagagaa
gttgttgactatcttattgatccatttgtagctggaacaagtgcaggagatccagagtca
ctatctatttgtcatgcattcccagcactgtggaatttggaaagaaaatatggttcagtt
gttgttggtgccatcttgtctaagctaacagctaaaggtgatccagtaaagacaagacgt
gattcatcagcgaaaagaaggaatagacgcgtgtcgttttcatttcatggtggaatgcag
tcactaataaatgcacttcacaatgaagttggagatgataatgtgaagcttggtacagaa
gtgttgtcattggcgtgtacattagatggagcccctgcaccaggcgggtggtcaatttct
gatgattcgaaggatgctagtggcaaggaccttgctaaaaaccaaacctttgatgctgtt
ataatgacagctccattgtcaaatgtccagaggatgaagttcacaaaaggtggagctcct
tttgttctagactttcttcctaaggtggattatctaccactatctctcatggtgactgct
tttaagaaggaagatgtcaagaaacctctggaaggatttggcgtcttaataccctacaag
gaacagcaaaaacatggtctaaaaacccttgggactctcttctcctcaatgatgttccca
gatcgagctcctgacgaccaatatttatatacaacatttgttgggggtagccacaataga
gatcttgctggagctccaacgtctattctgaaacaacttgtgacctctgaccttaaaaaa
ctcttaggcgtacaggggcaaccaacttttgtcaagcatatatactggggaaatgctttt
cctttgtatggtcatgattacaattctgtattggaagctatagaaaagatggagaaaaat
cttccagggttcttctacgcaggaaataacaaggatgggcttgctgttgggagtgttata
gcttcaggaagcaaggctgctgaccttgcaatctcgtatcttgaatctcacaccaagcat
aataatttacattga

  All links  
No link information was found.   
DBGET integrated database retrieval system