KEGG   Sorghum bicolor (sorghum): SORBI_06g020950Help
Entry
SORBI_06g020950   CDS       T01086                                 

Gene name
SORBIDRAFT_06g020950, Sb06g020950
Definition
hypothetical protein
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sbi00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 544 aa AA seqDB search
MLARTATVSSTSSHSHPYRPTSARSLRLRPVLAMAGSDDSRAAPARSVAVVGAGVSGLVA
AYRLRKSGVNVTVFEAADRAGGKIRTNSEGGFLWDEGANTMTEGELEASRLIDDLGLQDK
QQYPNSQHKRYIVKDGAPALIPSDPISLMKSSVLSTKSKIALFFEPFLYKKANTRNPGKV
SDEHLSESVGSFFERHFGREVVDYLIDPFVAGTSAGDPESLSICHAFPALWNLERKYGSV
VVGAILSKLTAKGDPVKTRRDSSAKRRNRRVSFSFHGGMQSLINALHNEVGDDNVKLGTE
VLSLACTLDGAPAPGGWSISDDSKDASGKDLAKNQTFDAVIMTAPLSNVQRMKFTKGGAP
FVLDFLPKVDYLPLSLMVTAFKKEDVKKPLEGFGVLIPYKEQQKHGLKTLGTLFSSMMFP
DRAPDDQYLYTTFVGGSHNRDLAGAPTSILKQLVTSDLKKLLGVQGQPTFVKHIYWGNAF
PLYGHDYNSVLEAIEKMEKNLPGFFYAGNNKDGLAVGSVIASGSKAADLAISYLESHTKH
NNLH
NT seq 1635 nt NT seq  +upstreamnt  +downstreamnt
atgctcgctcggactgccacggtctcctccacttcgtcccactcccatccttatcgcccc
acctccgctcgcagtctccgcctacgtccggtcctcgcgatggcgggctccgacgactcc
cgcgcagctcccgccaggtcggtcgccgtcgtcggcgccggggtcagcgggctcgtggcg
gcgtacaggctcaggaagagcggcgtgaatgtgacggtgttcgaggcggccgacagggcg
ggaggaaagatacggaccaattccgagggcgggtttctctgggatgaaggagcgaacacc
atgacagaaggtgaattggaggccagtagactgatagatgatctcggtctacaagacaaa
cagcagtatcctaactcccaacacaagcgttacattgtcaaagatggagcaccagcactg
attccttcggatcccatttcgctgatgaaaagcagtgttctttctacaaaatcaaagatt
gcgttattttttgaaccatttctctacaagaaagctaacacaagaaaccctggaaaagta
tctgatgagcatttgagtgagagtgttgggagcttctttgaacgccacttcggaagagaa
gttgttgactatcttattgatccatttgtagctggaacaagtgcaggagatccagagtca
ctatctatttgtcatgcattcccagcactgtggaatttggaaagaaaatatggttcagtt
gttgttggtgccatcttgtctaagctaacagctaaaggtgatccagtaaagacaagacgt
gattcatcagcgaaaagaaggaatagacgcgtgtcgttttcatttcatggtggaatgcag
tcactaataaatgcacttcacaatgaagttggagatgataatgtgaagcttggtacagaa
gtgttgtcattggcgtgtacattagatggagcccctgcaccaggcgggtggtcaatttct
gatgattcgaaggatgctagtggcaaggaccttgctaaaaaccaaacctttgatgctgtt
ataatgacagctccattgtcaaatgtccagaggatgaagttcacaaaaggtggagctcct
tttgttctagactttcttcctaaggtggattatctaccactatctctcatggtgactgct
tttaagaaggaagatgtcaagaaacctctggaaggatttggcgtcttaataccctacaag
gaacagcaaaaacatggtctaaaaacccttgggactctcttctcctcaatgatgttccca
gatcgagctcctgacgaccaatatttatatacaacatttgttgggggtagccacaataga
gatcttgctggagctccaacgtctattctgaaacaacttgtgacctctgaccttaaaaaa
ctcttaggcgtacaggggcaaccaacttttgtcaagcatatatactggggaaatgctttt
cctttgtatggtcatgattacaattctgtattggaagctatagaaaagatggagaaaaat
cttccagggttcttctacgcaggaaataacaaggatgggcttgctgttgggagtgttata
gcttcaggaagcaaggctgctgaccttgcaatctcgtatcttgaatctcacaccaagcat
aataatttacattga

DBGET integrated database retrieval system