KEGG   Sorghum bicolor (sorghum): SORBI_06g024310Help
Entry
SORBI_06g024310   CDS       T01086                                 

Gene name
SORBIDRAFT_06g024310, Sb06g024310
Definition
hypothetical protein
Orthology
K05609  
ubiquitin carboxyl-terminal hydrolase L3 [EC:3.4.19.12]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SORBI_06g024310 (SORBIDRAFT_06g024310)
Peptidases [BR:sbi01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   SORBI_06g024310 (SORBIDRAFT_06g024310)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 225 aa AA seqDB search
MVKRWLPLEANPDVMNQFMWGLGVPEDVGFCDVYGLDDELLAMVPQPVLAVILLYPQDRI
KESQASATSSVETKEPSKNVYFTKQTVGNACGTVGIIHALGNATSRIKLAEGSYFDRFYK
RTADMDPSQRATFLEEDEEMENAHSITATAGDTEAKDGVIEHYICFSCVDGELYELDGGT
SQPIPHGPSTPDTLLQDAAKVIKARLSMYSQSNNFNVMALSGKVI
NT seq 678 nt NT seq  +upstreamnt  +downstreamnt
atggtgaagcggtggctccccctcgaggccaatcccgacgtcatgaaccagttcatgtgg
ggactgggggtccccgaggacgtggggttctgcgatgtgtacggcctcgatgacgagttg
ctcgccatggtgccccagccggtgctcgcagtcatacttctctaccctcaggaccggatc
aaggaatcccaagcttcagctacctcgtcggtggagaccaaggagcccagcaagaatgta
tatttcacaaaacaaactgttgggaacgcctgtggcacagttggtattattcatgcactg
gggaatgctacttccagaatcaagctagctgaggggtcatatttcgatagattttataaa
cgaactgctgacatggatcctagccagcgtgctacatttcttgaggaggacgaggaaatg
gagaatgctcattccattaccgctactgctggtgacacagaggccaaggatggagtaatt
gaacattacatttgtttctcttgcgtcgatggagaactttatgagcttgatggggggaca
tcacagccaataccccatgggccttccactcctgataccttgttgcaggatgctgcaaaa
gttataaaagcaagactttccatgtattcccagtcaaacaacttcaatgtcatggctctt
tcaggcaaagtgatatag

DBGET integrated database retrieval system