KEGG   Sorghum bicolor (sorghum): SORBI_06g024920Help
Entry
SORBI_06g024920   CDS       T01086                                 

Gene name
SORBIDRAFT_06g024920, Sb06g024920
Definition
hypothetical protein
Orthology
K00432  
glutathione peroxidase [EC:1.11.1.9]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glutathione metabolism
Arachidonic acid metabolism
Class
Metabolism; Lipid metabolism; Arachidonic acid metabolism [PATH:sbi00590]
Metabolism; Metabolism of other amino acids; Glutathione metabolism [PATH:sbi00480]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 168 aa AA seqDB search
MAAASSATSVHDFTVKDASGKDVDLSTYKGKVLLIVNVASQCGLTNSNYTELAQLYEKYK
DQGFEILAFPCNQFGGQEPGTNEEIVQFACTRFKAEYPIFDKVDVNGNNAAPIYKFLKSS
KGGLFGDSIKWNFSKFLVDKEGRVVDRYAPTTSPLSIEKDIKKLLGSS
NT seq 507 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgcgtcgtccgccacctccgtccacgacttcaccgtcaaggatgccagcggc
aaagacgttgacctcagcacctacaaggggaaggttcttctcatcgttaacgtcgcatcc
cagtgtggcttaaccaactccaactacaccgagctggcccagctctatgagaagtacaag
gaccaaggctttgaaattctggctttcccatgcaaccagtttggtgggcaggagcctggt
accaacgaggagattgtgcagtttgcctgcacacgcttcaaggctgagtaccccatcttc
gacaaggttgatgtcaatggtaacaatgctgcgcccatctacaagtttctgaaatctagc
aagggtggcctttttggcgacagcatcaagtggaacttttccaagttcttggttgacaag
gagggacgtgttgtggatcgctatgctccaacaacttcacctctgagcattgagaaggat
atcaagaagctgcttgggagctcttaa

DBGET integrated database retrieval system