KEGG   Sorghum bicolor (sorghum): SORBI_06g027605Help
Entry
SORBI_06g027605   CDS       T01086                                 

Gene name
SORBIDRAFT_06g027605, Sb06g027605
Definition
hypothetical protein
Orthology
K08825  
dual-specificity tyrosine-(Y)-phosphorylation regulated kinase [EC:2.7.12.1]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.1  dual-specificity kinase
     SORBI_06g027605 (SORBIDRAFT_06g027605)
Protein kinases [BR:sbi01001]
 Serine/threonine protein kinases: CMGC group
  DYRK family [OT]
   SORBI_06g027605 (SORBIDRAFT_06g027605)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 233 aa AA seqDB search
FVARLTAGIIQTYLQCDPEFKYSEVLNPKRFLTNPSTPAHNDGLDNANWDLILYVNLELV
NKMSNRRFIVKEMLGQGTFGQVVKCWDTETNDYVAVKVIKNQPAFYHQAIMEVSLLRTLN
QKFDPDDQHNIVRMLDYLSFQNHLCIAFEMLGQNLYELLKRNHLRGLKLKYVQAFSKQIL
DAMVVMREAGIIHCDLKPENILLAPSVATAAAVKVIDFGSACLEGKTVYSYIQ
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
tttgttgcaagattgacagcaggcatcattcagacatatctacaatgtgatcctgagttt
aagtactcagaggttctaaatccaaaacgcttcctcaccaatccctctaccccagcccac
aatgatgggcttgacaatgcaaattgggacctcatattgtatgtcaacttggagttggtt
aataagatgtcaaacagaaggtttattgtcaaggaaatgcttgggcagggaacttttggt
caagtagttaagtgctgggacacagaaactaatgactatgttgctgtgaaggtgataaaa
aatcagcctgcattttaccatcaagctatcatggaggtttcgttattaagaacgttaaat
cagaaatttgatcctgatgatcagcataacattgtccgtatgcttgattatctgtcgttt
caaaatcatttgtgcatagcttttgagatgctgggtcaaaacctgtatgaactgctcaaa
aggaatcacttaagaggtctgaaactgaaatacgttcaagccttctcaaaacagatattg
gatgccatggttgtgatgagagaagctggaataattcattgtgatctcaagccagaaaat
atcctgttagctcccagtgtcgcaacagctgcagcagtgaaagttattgattttggatca
gcatgcctggagggtaaaacagtttactcgtacatccag

DBGET integrated database retrieval system