KEGG   Sorghum bicolor (sorghum): SORBI_06g030580Help
Entry
SORBI_06g030580   CDS       T01086                                 

Gene name
SORBIDRAFT_06g030580, Sb06g030580
Definition
hypothetical protein
Orthology
K11366  
ubiquitin carboxyl-terminal hydrolase 22/27/51 [EC:3.1.2.15]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SORBI_06g030580 (SORBIDRAFT_06g030580)
Peptidases [BR:sbi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SORBI_06g030580 (SORBIDRAFT_06g030580)
Transcription machinery [BR:sbi03021]
 Eukaryotic type
  RNA polymerase II system
   Coactivators
    SAGA/TFTC/STAGA complex
     SORBI_06g030580 (SORBIDRAFT_06g030580)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 565 aa AA seqDB search
MSTPSAPPPCPHLAAHRLSSRPLRFLRRCLRVRPLGRPEIRRDPRELPRCSPCAAAAPSP
TSRLYACLSCAAVFCPSHAASHASASAGPGHQIAVDVDRAELFCAACGDQVYDPDFDHAV
FLAQSSSLLPSTSASSPSPSAALRKRRRVDYRAWAPDPAEFALMSSADPTTSASAAAPAG
LRGLNNLGNTCFMNSVLQALLHAPPLRNYFLGDRHNRFLCPRRTPVRHRATDADAARVAC
LACDLDEIYSAAFSGERMPYSPAKFLYSWWQHASNLASYEQQDAHEFFISILDHIHENIK
DDQQKSHAQAQGHGDCCIAHRVFSGILRSDVTCTSCGFTSTTFEPCMDISLDMDAGDNSS
FGVANTKPHVRNGERGLAGMNSKVSTLMRCLERFTRSERLDAEQKFFCEHCNERQESLKQ
MSIRRLPLVSCFHIKRFEHSSVKKVSRKVDHCLQFPFSLDMAPYLSSSILRSRYGNRIFP
AEASDADAVSEMSSEFEIFAVITHSGKLEAGHYVTYLRLNNHWYKCDDAWVTRVEEHTVR
TSQAYMLFYVQKTLYYKACERAATV
NT seq 1698 nt NT seq  +upstreamnt  +downstreamnt
atgtccaccccgtcggcgccaccgccctgcccgcacctcgccgcgcaccgcctgtcgtcg
cgcccgctgcgcttcctccgccgctgcctgcgcgtgcgcccgctcggccgccccgagatc
cggcgggacccgcgcgagctgccgcgctgctcgccctgcgccgccgcggccccgtccccc
acctcccgcctctacgcctgcctctcctgcgccgccgtcttctgcccctcccacgccgcc
tcgcacgcctccgcctccgcggggcccggccaccagatcgccgtcgacgtcgaccgcgcc
gagctcttctgcgccgcctgcggggaccaggtctacgatcccgatttcgaccacgccgtc
ttcctcgcccagtcctcctcgctcctcccctccacctccgcctcctccccgtccccgtcc
gcggcgctccgcaagcgccggcgcgtggattaccgcgcatgggcgccagatccggccgag
ttcgcgctcatgagctccgcggaccccaccacatccgcctccgccgccgcaccggcgggg
ctgcgggggctcaacaatctcggcaacacctgcttcatgaactccgtgctccaggcgctc
ctccacgcgcccccgcttcggaactacttcctcggcgatcgccacaatcggttcctctgc
ccgcgccgcacgcccgtcagacaccgcgccacggacgccgacgccgccagggtcgcgtgc
ctcgcttgtgacctcgacgagatctactctgcggccttctccggggagcgcatgccgtac
agccccgccaagtttctatatagttggtggcagcatgcatcaaacctcgcaagctacgag
caacaggatgctcatgaattctttatttccatccttgaccatatccatgaaaatataaag
gacgaccaacaaaagtcacatgcccaagcccaaggccatggggactgttgcattgcccac
agagtgttttctggtatcctgaggtcagatgtcacctgcacaagctgtgggttcacatcc
acaacttttgagccctgtatggacatttctttggacatggatgctggagataacagttct
tttggtgttgcaaatacaaagccgcatgtgcgcaatggggaacgtggcttggctggcatg
aattccaaggtgtcaacactaatgaggtgtttggaacggtttacaaggtctgagagactt
gatgctgagcaaaagttcttctgtgaacactgcaacgagaggcaagagtccctgaagcaa
atgtccattcgcaggcttccattagtttcctgctttcacataaagagatttgagcattca
tcagtcaaaaaggtgtcgaggaaagttgatcactgtttgcagtttcctttctcccttgac
atggcaccttatttgtcatcatctattctcagaagtagatatggtaaccgcatatttcct
gcagaagctagtgatgcagatgcagtttcagaaatgtcatcagaatttgaaatatttgca
gtgatcacgcatagcggtaagctagaagctggccattatgtgacatatctgaggttaaac
aatcattggtacaaatgtgatgatgcctgggtaaccagagttgaggagcatactgtcagg
acttctcaggcatacatgctcttctatgtgcagaagacgctttactacaaagcttgtgaa
agagcagccacagtctaa

DBGET integrated database retrieval system