KEGG   Sorghum bicolor (sorghum): SORBI_06g030600Help
Entry
SORBI_06g030600   CDS       T01086                                 

Gene name
SORBIDRAFT_06g030600, Sb06g030600
Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Class
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:sbi00561]
Organismal Systems; Environmental adaptation; Plant-pathogen interaction [PATH:sbi04626]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 523 aa AA seqDB search
MAGEGEEVYVAAIDQGTTSTRFIVYDRHAKPVASHQLEFTQHYPEAGWVEHDPMEIIETV
MVCMNEAVGKAKDGKYNVVAGLKAIGITNQRETTVMWSKSTGHPLYNAIVWMDARTSPVC
RRLESELSGGRTHFVERCGLPISTYFSALKLLWLMENVDAVKDAIKTGDALFGTIDTWLI
WNLTGGVAGGQHVTDCSNASRTMLMNLKTLDWDKPTLDVLGVPVEILPKIISNSEKIGVV
AKEFPFAGVPISGCLGDQHAAMLGQLCKKGEAKSTYGTGAFILLNTGEEPTQSSHGLLST
IAYKLGPTAPTNYALEGSIAIAGAAVQWLRDSLGIIQTAAEIEKLAETVPDSGGVYFVPA
FNGLFAPWWRDDARGICIGITRFTNKGHIARAVLESMSFQVNDVLSSMHKDAGEAGEVKS
AEGEFLLRVDGGATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAAGVWTKEQV
FAGLHKENTTVFRPKLDEAHRKKRADSWYKAVSRSFDLADLSL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggaaggggaggaggtgtacgtggcggccatcgaccagggcaccaccagcacc
aggttcatcgtctacgaccgccacgccaagcccgtcgcctcgcaccagctcgagttcacg
cagcactacccggaggcagggtgggttgagcatgatcctatggagattatagagactgtt
atggtgtgtatgaatgaggcagttggcaaagccaaagatggtaaatacaatgtggttgct
ggtttgaaggccattgggatcacaaatcagagggaaaccactgttatgtggagtaaatcc
actggccatccactttataatgccattgtgtggatggatgctcgcacaagccccgtttgc
aggagattagaaagtgagctatcaggcggtagaacccactttgtggagagatgtgggctg
ccaatcagtacctatttcagtgctctgaaattattatggttgatggaaaatgtggatgct
gtcaaggatgcaatcaagactggtgacgccttatttggcacaatcgacacctggttgatt
tggaaccttactggaggtgttgctggtgggcagcatgtcacagattgctcaaatgcatct
cgtacaatgcttatgaatctaaagacacttgactgggataagccaacacttgatgtgtta
ggagttcctgttgagattttgccaaagattatcagtaattcagagaaaattggtgtggtc
gccaaagagttcccctttgcaggtgtccccatctcagggtgccttggagatcagcatgct
gctatgcttgggcagttgtgcaagaagggtgaagcgaaaagcacctatggaactggtgcc
ttcattcttcttaacacaggggaagaacctacccagtcctcccacggtcttcttagcact
atcgcatataagcttggcccaactgcacccactaattatgcccttgaaggatccattgca
attgctggagcagcagttcagtggttgagggatagccttggaatcattcaaacagcagcc
gaaattgaaaagttggctgaaactgtaccggattcaggtggtgtatactttgtgccagca
ttcaatgggttgtttgcaccatggtggagggatgatgcaagggggatctgcattggaatc
acaaggttcacgaataagggtcacattgctcgagcagtacttgagagtatgtcctttcag
gtgaatgatgtccttagctccatgcacaaggatgctggagaggcgggagaagtaaagagt
gcagaaggggaattcttgttgcgtgttgatggtggcgctactgttaataatcttctaatg
cagattcaggctgatctattgggtagccctgttgtcagaccagctgacatagagacgaca
gcccttggagctgcatatgcagctggtttggccgctggagtctggacgaaggagcaagta
ttcgcaggtttgcacaaggagaacacgacggtcttccgcccaaaactggatgaggcccac
aggaagaagcgagcagattcatggtacaaggcggtgtcaagatcatttgacttggctgat
ctttccctttaa

DBGET integrated database retrieval system