KEGG   Sorghum bicolor (sorghum): SORBI_06g030600Help
Entry
SORBI_06g030600   CDS       T01086                                 

Gene name
SORBIDRAFT_06g030600, Sb06g030600
Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycerolipid metabolism
Metabolic pathways
Plant-pathogen interaction
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    SORBI_06g030600 (SORBIDRAFT_06g030600)
 Organismal Systems
  Environmental adaptation
   04626 Plant-pathogen interaction
    SORBI_06g030600 (SORBIDRAFT_06g030600)
Enzymes [BR:sbi01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     SORBI_06g030600 (SORBIDRAFT_06g030600)
Exosome [BR:sbi04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   SORBI_06g030600 (SORBIDRAFT_06g030600)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 523 aa AA seqDB search
MAGEGEEVYVAAIDQGTTSTRFIVYDRHAKPVASHQLEFTQHYPEAGWVEHDPMEIIETV
MVCMNEAVGKAKDGKYNVVAGLKAIGITNQRETTVMWSKSTGHPLYNAIVWMDARTSPVC
RRLESELSGGRTHFVERCGLPISTYFSALKLLWLMENVDAVKDAIKTGDALFGTIDTWLI
WNLTGGVAGGQHVTDCSNASRTMLMNLKTLDWDKPTLDVLGVPVEILPKIISNSEKIGVV
AKEFPFAGVPISGCLGDQHAAMLGQLCKKGEAKSTYGTGAFILLNTGEEPTQSSHGLLST
IAYKLGPTAPTNYALEGSIAIAGAAVQWLRDSLGIIQTAAEIEKLAETVPDSGGVYFVPA
FNGLFAPWWRDDARGICIGITRFTNKGHIARAVLESMSFQVNDVLSSMHKDAGEAGEVKS
AEGEFLLRVDGGATVNNLLMQIQADLLGSPVVRPADIETTALGAAYAAGLAAGVWTKEQV
FAGLHKENTTVFRPKLDEAHRKKRADSWYKAVSRSFDLADLSL
NT seq 1572 nt NT seq  +upstreamnt  +downstreamnt
atggcgggggaaggggaggaggtgtacgtggcggccatcgaccagggcaccaccagcacc
aggttcatcgtctacgaccgccacgccaagcccgtcgcctcgcaccagctcgagttcacg
cagcactacccggaggcagggtgggttgagcatgatcctatggagattatagagactgtt
atggtgtgtatgaatgaggcagttggcaaagccaaagatggtaaatacaatgtggttgct
ggtttgaaggccattgggatcacaaatcagagggaaaccactgttatgtggagtaaatcc
actggccatccactttataatgccattgtgtggatggatgctcgcacaagccccgtttgc
aggagattagaaagtgagctatcaggcggtagaacccactttgtggagagatgtgggctg
ccaatcagtacctatttcagtgctctgaaattattatggttgatggaaaatgtggatgct
gtcaaggatgcaatcaagactggtgacgccttatttggcacaatcgacacctggttgatt
tggaaccttactggaggtgttgctggtgggcagcatgtcacagattgctcaaatgcatct
cgtacaatgcttatgaatctaaagacacttgactgggataagccaacacttgatgtgtta
ggagttcctgttgagattttgccaaagattatcagtaattcagagaaaattggtgtggtc
gccaaagagttcccctttgcaggtgtccccatctcagggtgccttggagatcagcatgct
gctatgcttgggcagttgtgcaagaagggtgaagcgaaaagcacctatggaactggtgcc
ttcattcttcttaacacaggggaagaacctacccagtcctcccacggtcttcttagcact
atcgcatataagcttggcccaactgcacccactaattatgcccttgaaggatccattgca
attgctggagcagcagttcagtggttgagggatagccttggaatcattcaaacagcagcc
gaaattgaaaagttggctgaaactgtaccggattcaggtggtgtatactttgtgccagca
ttcaatgggttgtttgcaccatggtggagggatgatgcaagggggatctgcattggaatc
acaaggttcacgaataagggtcacattgctcgagcagtacttgagagtatgtcctttcag
gtgaatgatgtccttagctccatgcacaaggatgctggagaggcgggagaagtaaagagt
gcagaaggggaattcttgttgcgtgttgatggtggcgctactgttaataatcttctaatg
cagattcaggctgatctattgggtagccctgttgtcagaccagctgacatagagacgaca
gcccttggagctgcatatgcagctggtttggccgctggagtctggacgaaggagcaagta
ttcgcaggtttgcacaaggagaacacgacggtcttccgcccaaaactggatgaggcccac
aggaagaagcgagcagattcatggtacaaggcggtgtcaagatcatttgacttggctgat
ctttccctttaa

DBGET integrated database retrieval system