KEGG   Sorghum bicolor (sorghum): SORBI_06g031360Help
Entry
SORBI_06g031360   CDS       T01086                                 

Gene name
SORBIDRAFT_06g031360, Sb06g031360
Definition
hypothetical protein
Orthology
K01792  
glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycolysis / Gluconeogenesis
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SORBI_06g031360 (SORBIDRAFT_06g031360)
Enzymes [BR:sbi01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     SORBI_06g031360 (SORBIDRAFT_06g031360)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 335 aa AA seqDB search
MSASASSPPAGEENKQEAAPVRHCKGVNDLDKVVLREVRGSSAEVYLYGGHVTSWKDEHG
DELLFVSNKAIFKPPKAIRGGIPICFPQFSNFGNLEQHGFARNRTWCVDDDPPPFPVPTS
NTAFVDLILKPTEEDLKIWPHSFEYRLRVALSPGGDLMLTSRIRNTNADGKSFSFTFAYH
TYFKISDISEVRVEGLETLDYLDNLQDRARFTEQGDAIVFESELDRIYLGTPSKIAIIDH
EKKRTFVVRKGGLPDAVVWNPWDKKAKAMSDFGDDEYKRMVCVEAAAIEKPVTLKPGEEW
TGKLELSAVPSSYYSGQLDPDRVIQDSTVPEDSIS
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
atgtcggcctcggcgtcgtcgccgccggcgggagaggagaacaagcaggaggcggcgcca
gtcaggcactgcaagggcgtcaacgacctcgacaaggtcgtgctccgcgaggtccggggc
agctccgcagaggtgtacttgtacggtgggcatgtgacatcatggaaagatgagcatgga
gacgagttactttttgttagcaataaggctattttcaagcctccaaaagctatacgtgga
ggaataccgatctgctttccacagttttccaactttgggaatctggaacaacatggattt
gcaaggaatagaacatggtgtgttgatgatgatcctccaccatttccagtgccaacctcc
aatacagcttttgtggacttgatcctcaaacctactgaagaggatttgaagatctggcct
catagttttgagtaccgcctgagggttgcacttagtcctggtggtgatttgatgctaact
tcacgtataagaaacactaatgcagatgggaagtcattctctttcacttttgcataccac
acatacttcaagatttctgatatcagtgaggtgcgagtagaaggtttggaaactctggat
tacctagataacttacaagatagagcccgtttcactgaacaaggcgatgcaattgttttt
gaatccgaactggacagaatatatctgggcactccgtcaaaaattgcgattattgaccat
gagaagaaaagaacatttgttgtgaggaaaggaggccttcctgatgctgttgtttggaac
ccctgggataaaaaagcgaaggctatgtcagattttggggatgatgaatataaacgaatg
gtatgcgtggaggcggcggctatagagaagcctgtcactctgaagcctggtgaggagtgg
actggaaagttggaactttctgctgtgccatctagttattacagtggtcagctagatcct
gaccgtgtgattcaggattctactgtcccggaggactcaatcagctag

  All links  
No link information was found.   
DBGET integrated database retrieval system