KEGG   Sorghum bicolor (sorghum): SORBI_06g032240Help
Entry
SORBI_06g032240   CDS       T01086                                 

Gene name
SORBIDRAFT_06g032240, Sb06g032240
Definition
hypothetical protein
Orthology
K06130  
lysophospholipase II [EC:3.1.1.5]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycerophospholipid metabolism
Class
Metabolism; Lipid metabolism; Glycerophospholipid metabolism [PATH:sbi00564]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 264 aa AA seqDB search
MSSLVRFLFTLAAAIAAASLLVASLRRRAPPPGLPAKLIPSSHMAGRNRSFVLWLHGLGD
SGPANEPIRNLFSAPEFRLAKWSFPSAPRAPVSCNNGFVMPSWFDIHELPMSAGSPQDEA
GVLKAVEKVHAMIDREVADGIHPENIFVCGFSQGGALTLASVLLYPKKLGGGAVFSGWVP
FGSSVTEKISPEARKTPFLWSHGMADKVVLFEAGQAGPPFLQSAGVNCEFKAYPDLGHSL
SKEELLYLESWIKSRLNASQEKDG
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcctggtccgcttcctcttcaccctcgccgcggccatcgccgcagcctcgctc
ctcgtcgcctccctccgccgccgcgcgccgcctcccgggcttcccgcaaagctcatcccc
tcctcccacatggcgggacgcaaccggagcttcgtactgtggctgcacggcctcggcgat
tctggcccagccaacgagcccatccgcaacctcttctctgccccggagttccggctcgcc
aagtggtcgttcccctccgccccccgcgcccccgtctcctgcaacaatggttttgtcatg
ccgtcgtggttcgatatccacgagcttcccatgagcgctgggtccccgcaagatgaggct
ggggttctcaaggctgtggaaaaggtgcacgccatgatagacagggaagtagccgatggc
atccaccctgagaacatatttgtttgtggatttagccaaggaggtgctctgacattagct
agcgtattactttatccgaaaaagttaggtggaggagcagtgttcagcggttgggtgcct
ttcggttcatcagtcaccgagaagatttcacctgaagcgaggaagaccccatttctttgg
tcacatggaatggctgacaaagtagtattgtttgaagctggtcaagctggtccaccattt
ttgcaaagtgcgggtgttaactgtgaattcaaggcatatccagatctgggccattccctt
tccaaagaagagctactttatctcgagtcatggatcaagagtcgtctaaatgcctctcaa
gaaaaggacggttaa

DBGET integrated database retrieval system