KEGG   Sorghum bicolor (sorghum): SORBI_06g032740Help
Entry
SORBI_06g032740   CDS       T01086                                 

Gene name
SORBIDRAFT_06g032740, Sb06g032740
Definition
hypothetical protein
Orthology
K03403  
magnesium chelatase subunit H [EC:6.6.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SORBI_06g032740 (SORBIDRAFT_06g032740)
Enzymes [BR:sbi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SORBI_06g032740 (SORBIDRAFT_06g032740)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
6
AA seq 1381 aa AA seqDB search
MSSSLVSTPFAAAAQKQLLAAPVPLHSFLLSSRRQPGRRGGAGAIRCAVAGGNGLFTQTK
PEVRRVVPTDPRGLPRVKVVYVVLEAQYQSSVTAAVQQLNADPRRAAAFEVVGYLVEELR
DEDTYATFCADLADANVFIGSLIFVEELALKVKAAVEKERDRMDAVLVFPSMPEVMRLNK
LGSFSMSQLGQSKSPFFQLFKRNKSNSSNFADSMLKLVRTLPKVLKYLPSDKAQDARLYI
LSLQFWLGGSPDNLQNFLKMIAGSYVPALRGAGIKYDDPVLYLDSGIWHPLAPTMYEDVK
EYLNWYGTRRDTNDRLKDPNAPVIGLVLQRSHIVTGDDGHYVAVIMELEAKGAKVIPIFA
GGLDFSGPTQRYLVDPITGKPFVNAVVSLTGFALVGGPARQDHPKAIAALQKLDVPYIVA
LPLVFQTTEEWLNSTLGLHPIQVALQVALPELDGGMEPIVFAGRDPRTGKSHALHKRVEQ
LCTRAIRWAQLKRKTKEEKKLAITVFSFPPDKGNVGTAAYLNVFNSIYSVLSDLKKDGYN
VEGLPDTPEALIEEVIHDKEAQFNSPNLNVAYRMNVREYQALTSYASLLEENWGKPPGHL
NSDGENLLVYGKQYGNVFIGVQPTFGYEGDPMRLLFSKSASPHHGFAAYYTFVEKIFQAD
AVLHFGTHGSLEFMPGKQVGMSDACFPDSLIGNIPNIYYYAANNPSEATVAKRRSYANTI
SYLTPPAENAGLYKGLKQLSELISSYQSLKDTGRGTQIVSSIISTAKQCNLDKDVPLPEE
GEELPPSERDLVVGKVYSKIMEIESRLLPCGLHVIGEPPSAIEAVATLVNIAALDRPEDG
IISLPGILAATVGREIEDVYRGSDKGILADVELLRQITEASRGAITAFVEKTTNSKGQVV
NVANNLSNILGFGLSEPWVQYLSTTKFIRADREKLRVLFGFLGECLKLVVQDNELGSLKL
ALEGSYVEPGPGGDPIRNPKVLPTGKNIHALDPQAIPTTAALKSAKIVVDRLLERQKADN
GGKYPETVALVLWGTDNIKTYGESLAQVLWMIGVRPVADTFGRVNRVEPVSLEELGRPRI
DVVVNCSGVFRDLFINQMNLLDRAVKMVAELDEPAEMNYVRKHAQEQAEELGVSLREAAT
RVFSNASGSYSSNVNLAVENASWTDEKQLQDMYLSRKSFAFDSDAPGAGMKEKRKAFELA
LATADATFQNLDSSEISLTDVSHYFDSDPTKLVQGLRKDGRAPSSYIADTTTANAQVRTL
SETVRLDARTKLLNPKWYEGMMKSGYEGVREIEKRLTNTVGWSATSGQVDNWVYEEANST
FIEDEAMRKRLMETNPNSFRKLVQTFLEASGRGYWETSEENLDRLRELYSEVEDKIEGID
R
NT seq 4146 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtcgtctctagtgtccaccccattcgccgccgcggcgcagaagcagctcctggcg
gcgcccgtgccgctgcactcgttcctcctgagcagccggcgccagccggggcgtcgtggc
ggtgccggcgccatccggtgcgcggtcgccggcggcaacggcctgttcacgcagaccaag
cccgaggtgcggcgcgtggtgccgaccgacccgcggggcctgccgcgggtcaaggtcgtc
tacgtcgtgctggaggcgcagtatcagtcgtccgtcacggccgccgtgcagcaactcaac
gccgacccgcgccgcgccgcggcgttcgaggtcgtgggatacctcgtcgaggagctccgc
gacgaggacacctacgccaccttctgcgccgacctcgccgacgccaacgtcttcatcggc
tccctcatcttcgtcgaggagctggcgctcaaggtcaaggctgccgtcgagaaggagcgc
gaccgcatggacgccgtcctcgtcttcccctccatgcccgaggtcatgcgcctcaacaag
ctcggctccttcagcatgtcgcagctggggcagtccaagagccccttcttccagctcttc
aagcgcaacaagtccaactccagcaacttcgccgacagcatgctcaagctcgtgcgcacg
ctgcccaaggtgctcaagtacctgccctccgacaaggcgcaggacgccaggctctacatc
ctcagcctccagttctggctcggcggctcgccggacaacctccagaacttcctcaagatg
atcgccggctcctacgtgccggcgctcaggggcgccggcatcaagtacgacgaccctgtg
ctctacctcgactccggcatctggcacccgctggcgcccaccatgtacgaggacgtcaag
gagtacctcaactggtacggcacgcgccgggacaccaacgacaggctcaaggaccccaac
gcgcccgtcatcggcctcgtcctgcagaggagccacattgtcaccggcgacgacgggcac
tacgtcgccgtcatcatggagctcgaggccaagggcgccaaggtcatacccatcttcgcc
ggcggtctcgacttctccgggcccacccaacgctacctggtcgacccgattactggcaag
ccgttcgtgaacgccgtggtgtctctcaccgggttcgcgctcgttggcgggccggcgagg
caggaccaccccaaggccattgccgcgttgcagaagctcgacgtgccgtacattgttgcg
cttccgctcgtgttccagaccacggaggagtggctcaacagcaccttggggcttcacccc
attcaggtggcgctgcaggtcgcgctgccggagctcgacggtgggatggagcccatcgta
ttcgccggccgggaccccaggacaggaaaatcacatgcattgcataagagagtggagcag
ctctgcactagagccatcagatgggcacaactgaagaggaaaactaaggaggagaagaaa
ctggcaatcactgttttcagtttcccacctgacaagggcaacgtggggactgcagcatat
ctgaatgtgttcaactccatctactctgtgctgtcagacctcaagaaggacggctacaac
gttgagggtctcccagacacaccggaagccctcatcgaggaggttatccatgacaaggag
gctcagttcaacagccccaacctcaatgtggcttaccgcatgaatgtgagggagtaccag
gcactcacctcctatgcctccttgctggaggagaactgggggaagccacctgggcacctc
aactctgatggcgagaacctccttgtctatgggaagcagtacggcaatgtcttcatcgga
gtgcagcccacttttgggtatgaaggcgatccgatgcggcttctgttctcaaagtctgcc
agccctcaccatggctttgcagcatactacacctttgttgagaagatcttccaggccgat
gctgttctgcactttggaacacacgggtccctggagttcatgcctggcaagcaggttggg
atgagtgatgcttgcttccctgacagcctcattggcaacatccccaacatctactactat
gccgcaaacaacccatcagaggctacggtcgccaagcgccggagctatgcaaacaccatc
agctacctgacaccaccagctgagaatgccggtctctacaaggggctcaagcagctatca
gagctcatctcctcttaccagtctctcaaggacactgggcgtggtactcagattgtgagc
tcaatcatcagcactgcaaaacagtgcaaccttgacaaggatgtcccactgcccgaggaa
ggggaggagctcccaccaagtgaacgtgacctggtcgttggaaaggtgtactccaagatc
atggagatagagtcacggctccttccctgtggtctacatgtgatcggtgagccaccgagc
gccatcgaagctgtggccacactggtgaacatagctgctctcgaccgcccagaggatggc
ataatctcgctgcctggcatacttgctgccacagtgggcagggagattgaagatgtgtac
aggggaagtgacaagggcatactggctgacgtcgagcttttgaggcagataactgaagct
tcgcgtggcgccatcaccgcctttgtagagaagaccacaaacagcaaagggcaagtcgtc
aatgttgccaacaacctcagcaacatacttggctttggtctgtcagagccatgggtgcag
tacctgtccacgaccaagttcatcagggcagacagagagaagctgagggttttgtttgga
ttcctgggggaatgcttgaagctcgtcgtgcaagacaatgagctgggcagcttgaagctc
gcccttgagggaagctatgtcgagcctggccctggtggtgacccgatccgtaacccgaag
gtgcttccgactgggaagaacatccatgctcttgacccacaggccatcccaaccacagct
gccttgaagagtgccaagatcgtcgtcgaccgtctcctggagaggcagaaggccgacaat
ggcggcaagtacccagagacagttgcacttgtcttgtggggcactgacaacatcaagacc
tatggtgagtcactggcccaggtgctgtggatgattggtgtacggccagttgctgacacc
ttcggccgtgtcaaccgtgtggagcctgtcagccttgaggagcttggacgtccaaggatt
gacgtcgtcgtcaattgctctggtgtcttcagagaccttttcatcaaccagatgaacctg
ctggaccgggcggtgaagatggtcgccgaactggacgagccagcagagatgaattacgtg
cgcaagcatgcccaggagcaggcagaggagctcggcgtctcgctgagagaggcggcgacg
agggtgttctcgaacgcatcaggctcctactcgtcgaacgtgaacctggcggtggagaac
gcgtcgtggacagacgagaagcagctccaggacatgtacctgagccggaaatccttcgcg
ttcgacagcgacgctccaggggcaggcatgaaggagaagcgcaaggcgttcgagctcgct
ctggcgacggcggacgccacgttccagaacctcgactcgtcggagatctcgctgacggac
gtgagccactacttcgactcggacccgacgaagctcgtgcaggggctgcgcaaggacggc
cgggcgccgtcgtcgtacattgctgacactaccacggcgaacgcccaggtgaggacgctg
tcggagacggtgcgcctcgacgcgaggaccaagctgctgaaccccaagtggtacgagggg
atgatgaagagcggatacgagggcgtcagggagatcgagaagcggctcaccaacaccgtt
gggtggagcgcgacgtctgggcaggtcgacaactgggtgtacgaggaggcgaactccacg
ttcatcgaagacgaggcgatgaggaagaggctcatggagaccaaccccaattcgttcagg
aagctggtgcagaccttcctggaagccagtggcagaggctactgggagacatcggaggag
aacctggacaggctcagggagctctactcggaggttgaagacaagattgaggggattgac
aggtaa

DBGET integrated database retrieval system