KEGG   Sorghum bicolor (sorghum): SORBI_07g001140Help
Entry
SORBI_07g001140   CDS       T01086                                 

Gene name
SORBIDRAFT_07g001140, Sb07g001140
Definition
hypothetical protein
Orthology
K17108  
non-lysosomal glucosylceramidase [EC:3.2.1.45]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Lipid metabolism
   00600 Sphingolipid metabolism
    SORBI_07g001140 (SORBIDRAFT_07g001140)
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    SORBI_07g001140 (SORBIDRAFT_07g001140)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.45  glucosylceramidase
     SORBI_07g001140 (SORBIDRAFT_07g001140)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 929 aa AA seqDB search
MGSEELQQAKVLSSIDCSQPPARTWQRRFDDEGKKVAMYSLTMNDLTAIVGVYDPLRKWM
DNCYRGVPLGGIGAGSIGRSYRGYFQQFQIFPATNEEKPILANQFSAFVSRPNGTKYSTV
LSAPTADLLKEVDKASIGSWDWKLKEEKCTYHALFPRSWTVYDGEPDPEIKITSRQISPF
IPHNYRESSFPAAVFTFTVHNSGSTAADVTLLFTWANSVGGKSELTGNHVNSKMTEQDGV
HGVLLHHRTAGGHPPVTFAIASQETDGVRVSVCPSFTMGPSGSRDFTAADMWDEIKKHGA
FGHAGAGNAARAASKAGSSLGAAVAASTTVPAGETRVVSFSLAWACPDIKFPAGSTYHRR
YTKFYGVDADAAAEQLAHDALLEHMNWESQIEEWQRPILNDKRLPEWYPVALFNELYYLN
AGGTIWTDGQPPKKAGFASSLTGTEPFSIDTLLAEDGGTGGSAVDGVVRAVASAKELSHS
AAAAFGAALLRDGEDNVGQFLYLEGMEYNMYNTYDVHFYASFALLSLFPSLELSLQRDFA
RAVLLHDPRRRRTFDGRTVPRKVLGTVPHDVGLNDPWVEMNEYMLHDPALWKDLNPKFVL
QVYRDAVATGDAAFAEAAWPAVYIAMAYMHQFDRDGDGMVENEGIPDQTYDIWSVSGVSA
YTGGLWVAALEAAAGMARVVGDRHAEAYFRGRRDRAARVYDAELWNGTYFRYDNSGGGAC
SESIMADQMAGQWYARACGMEPVVEEGKARSALATVLDYNVMRVKGGAVGAVNGMRPDGA
VDASSGQSKEVWPGVTYAVAAAMVHEGMHEAAFRTAKGAHDAGWGKDGFGYAFQTPEAWT
EDGGYRSLHYMRPLGIWAMQWALSPPELHKDLRAPGARSVEEESSPADAALGQAQFEKVA
NMLRLPEEKQPKGYLWAIYKVIRQMVLPE
NT seq 2790 nt NT seq  +upstreamnt  +downstreamnt
atgggaagtgaggagttgcagcaggccaaggtgctctcgagcatcgattgctcgcagccg
ccagcaagaacttggcaaaggagattcgacgatgaaggcaagaaggttgccatgtacagc
ttgaccatgaatgacttgacagcaattgttggtgtttatgatcctctgaggaagtggatg
gacaattgctaccgtggtgtaccgctcggtgggataggtgcaggaagcatagggagaagc
tacagagggtactttcagcaatttcagatattccccgcgacgaatgaagagaaacctatt
ctagcaaatcagttctcggcgtttgtttcgcgcccgaatgggaccaagtactccacggtg
ttgtcagcgccaaccgctgatcttctcaaggaagtcgataaagccagtattggatcttgg
gactggaagctgaaggaggagaaatgcacctaccatgccctgtttccaagatcatggaca
gtatatgatggtgagcctgaccctgagatcaagatcaccagccgtcagatatcgcccttc
atcccacacaactacagagagagcagcttcccggctgcagttttcacattcacggtacac
aactctgggagcacagctgcagatgtgacactgctcttcacctgggcaaattcagttggt
gggaaatcagaactgacaggaaaccacgtgaattccaaaatgacggagcaagacggcgtc
catggcgttctcctccaccacaggacggcgggagggcaccctccggtgacgttcgcgatc
gcatcccaagagaccgacggcgtccgcgtcagcgtctgtccgtccttcacgatgggcccg
tccggctcccgcgacttcacggcggcggacatgtgggacgagatcaagaagcacggcgcg
ttcgggcacgccggcgctggcaatgcggcgagggcggcgtcgaaggccgggtcgtcattg
ggcgcggcggtggcggcgtcgacgaccgtgcctgcgggggagacgcgggtggtgtccttc
tcgctggcctgggcgtgccccgacatcaagttccccgccggaagcacgtaccacaggagg
tacaccaagttctacggcgttgatgccgacgcagctgcagagcaactggctcatgacgct
cttcttgagcatatgaactgggagtcccagatcgaggaatggcagaggccaatcttgaat
gacaagaggctacctgaatggtatccagttgccctgttcaacgagctctactacctcaac
gctggaggcacaatctggacagacggacagcctcccaagaaggccggcttcgcttcgtcg
ttgacgggcaccgagccgttctcgatcgacacgctcctcgcggaagacggcggcactggc
ggcagcgcggtggacggcgtggtgcgcgcggtggcgtcggcgaaggagctgtcccactcc
gcggcggcggcgttcggcgcggcgctgctccgcgacggcgaggacaacgtggggcagttc
ctgtacctggaaggcatggagtacaacatgtacaacacctacgacgtgcacttctacgcc
tccttcgcgctgctctccctcttcccatcgctggagctgagcctgcagcgggacttcgcg
cgcgccgtgctcctccacgacccacgccggcggcgcaccttcgacggccggaccgtgccg
cggaaggtgctcggcaccgtgccgcacgacgtcgggctcaacgacccctgggtggagatg
aacgagtacatgcttcacgacccggcgctgtggaaggacctcaaccccaagttcgtcctc
caggtgtaccgcgacgccgtggccacgggcgacgccgcgttcgcggaggcggcgtggccg
gcggtgtacatagccatggcgtacatgcaccagttcgaccgtgacggggacgggatggtg
gagaacgaagggatccccgaccagacgtacgacatctggtccgtctccggcgtcagcgcc
tacacgggcgggctctgggtggcggcgctggaggcggcggcggggatggcgcgcgtcgtc
ggcgaccgccacgccgaggcctacttccgcggaaggcgcgacagggcggcgcgcgtgtac
gacgccgagctctggaacggcacctacttccggtacgacaacagcggcggcggcgcgtgc
agcgagtccatcatggcggaccagatggccgggcagtggtacgcgcgggcgtgcgggatg
gagcccgtcgtggaggaaggcaaggcgcggagcgcgctggcgacggtgctggactacaac
gtgatgcgggtgaaaggcggcgccgtcggggccgtgaacgggatgcgacccgacggcgcc
gtcgacgcgtcgtccgggcagtccaaggaggtgtggcctggcgtcacgtacgccgtcgcg
gcggccatggtgcacgagggcatgcacgaggccgcgttccggacggccaagggcgcacac
gacgccggctggggaaaggatgggttcgggtacgcgttccagacgccggaggcgtggacg
gaggacggcggctaccggtcgctgcattacatgcggccgctcggcatctgggcgatgcag
tgggcgctgtcgccgcctgagctccacaaggatctcagggcacccggcgcgcggtcggta
gaagaggagtcgtcgccggcggacgccgcactcgggcaggcacagttcgagaaggtggcg
aacatgctgaggctgccggaggagaagcagcctaagggatacctttgggccatctacaag
gtgattaggcagatggtgctcccagaatga

DBGET integrated database retrieval system