KEGG   Sorghum bicolor (sorghum): SORBI_07g002770Help
Entry
SORBI_07g002770   CDS       T01086                                 

Gene name
SORBIDRAFT_07g002770, Sb07g002770
Definition
hypothetical protein
Orthology
K01696  
tryptophan synthase beta chain [EC:4.2.1.20]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SORBI_07g002770 (SORBIDRAFT_07g002770)
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    SORBI_07g002770 (SORBIDRAFT_07g002770)
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    SORBI_07g002770 (SORBIDRAFT_07g002770)
Enzymes [BR:sbi01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     SORBI_07g002770 (SORBIDRAFT_07g002770)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 476 aa AA seqDB search
MAAATIRSPTRAAAAGGPAAAPTQQRSVLRVASSAASASSSSARTRRGAAAMQPAKAVAA
EAASPAVEMGNGAAVAGMQRPDAMGRFGKFGGKYVPETLMHALTELENAFHALATDEEFQ
KELDGILKDYVGRESPLYFAERLTEHYKRADGTGPLIYLKREDLNHTGAHKINNAVAQAL
LAKRLGKQRIIAETGAGQHGVATATVCARFGLQCIIYMGAQDMERQALNVFRMRLLGAEV
RAVHSGTATLKDATSEAIRDWVTNVETTHYILGSVAGPHPYPMMVREFHKVIGKETRRQA
MDKWGGKPDVLVACVGGGSNAMGLFHEFVEDQDVRLIGVEAAGHGVDTDKHAATLTKGEV
GVLHGSMSYLLQDDDGQVIEPHSISAGLDYPGVGPEHSFLKDIGRAEYDSVTDQEALDAF
KRVSRLEGIIPALETSHALAYLEKLCPTLPDGVRVVVNCSGRGDKDVHTASKYLDV
NT seq 1431 nt NT seq  +upstreamnt  +downstreamnt
atggccgccgccaccattcgcagccctacccgcgccgccgccgcaggaggacccgccgcg
gcgccgacgcagcagcgatcggtgctgcgggtggcgtcgtccgccgcgtcggcttcctcg
tcgtccgcccgcacgcggaggggtgcggccgcaatgcagccggccaaggcggtggccgcg
gaggcggcgtcccccgcggtggagatggggaacggcgcggcggtcgcggggatgcagagg
cccgacgccatggggaggttcgggaagttcggcgggaagtatgtccccgagacgctcatg
cacgcgctcaccgagctcgagaacgccttccacgcgctcgccaccgacgaagagttccag
aaagaacttgacggtattctcaaggactatgttggacgtgagagccccctctattttgcg
gagcgcctgacggagcactacaagcgcgccgatggcacaggcccgctcatctacctcaag
agggaggaccttaaccacaccggtgcccacaagatcaacaatgccgtggcgcaggccttg
ctcgccaagcgacttgggaagcagcgcatcattgctgagacaggggctggtcagcacggt
gtcgccactgccaccgtgtgcgcccgttttgggctgcagtgcatcatctacatgggtgcg
caagatatggagaggcaggcgctcaatgttttccggatgaggcttcttggtgcagaggtc
agggctgtacattctgggacagcaaccctgaaggatgcaacttcagaggctatccgcgac
tgggtcactaatgtggagactacacactacattttgggctctgttgctggtccgcaccca
tacccaatgatggtgagggagttccataaggttattggcaaggagacccggaggcaggcc
atggacaagtggggtggaaagccggatgtgttggttgcttgcgtcggtggtggatcaaac
gctatgggtttattccatgagtttgttgaggatcaagatgtgaggctgattggagtggag
gcagctggtcatggtgtagacactgacaagcatgctgctactttgacaaagggcgaagtt
ggagttctccacggatctatgagctacttgctgcaggacgatgatggacaagttattgaa
ccccactccatcagtgctgggctggactaccctggtgttggacccgagcacagtttcttg
aaggacattggacgtgctgaatacgacagcgtgactgatcaggaggcactggatgctttc
aagcgtgtctctcgtctggagggcatcatccctgccctggagacctcccatgcgctcgcc
tacctcgagaagctctgcccgaccctgccagacggcgtgagagtggtggtgaactgcagt
ggacgaggagacaaggacgtgcacaccgccagcaagtacctggacgtctaa

DBGET integrated database retrieval system