KEGG   Sorghum bicolor (sorghum): SORBI_07g003810Help
Entry
SORBI_07g003810   CDS       T01086                                 

Gene name
SORBIDRAFT_07g003810, Sb07g003810
Definition
hypothetical protein
Orthology
K04371  
mitogen-activated protein kinase 1/3 [EC:2.7.11.24]
Organism
sbi  Sorghum bicolor (sorghum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 388 aa AA seqDB search
MRMEGGGGGGAGGVGGCLGLGHGGEAQIKGTHTHGGRYVQYNVYGTLFEVSAKYVPPIRP
VGRGAIGIICAAVNAQTREEVAIKKIGNAFDNQIDAKRTLREIKLLRHMNHENVISIKDI
IRPPRRENFNDVYIVYELMDTDLHHLLRSNQTLTDDHCQYFVYQLLRGLKYVHSANVLHR
DLRPSNLLLNAKCDLKIGDFGLARTTTETDFMMEYVVTRWYRAPELLLNCSEYTQAIDMW
SVGCIFGEMVTREPLFPGKDYVHQLLLITELVGSPDDTSLGFLRSDHARRYVRSLPQHPK
QQFRVRFPTMSSGAMDLLERMLVFDPSKRITVDEALCHPYLASLHEINDEPVCPAPFSFD
FEQPSLTEEDIKELIWRESLKFNPDPIH
NT seq 1167 nt NT seq  +upstreamnt  +downstreamnt
atgcgcatggagggtggcggaggaggaggcgccggcggtgtcggagggtgcctgggtctg
ggccacggcggggaggcgcagatcaagggaacgcacacgcacggcggccgctacgtgcag
tacaacgtgtacggcaccctcttcgaggtctccgccaagtacgtcccgcccatccgcccc
gtcggccgcggcgccatcggcatcatctgtgctgctgtcaatgcgcagactcgcgaggaa
gtcgccatcaagaagatcggcaacgcgttcgacaatcagatcgacgcaaagcgcactctg
cgtgaaattaagttgcttaggcacatgaatcatgaaaatgttatttcaataaaggacatc
atacgcccacccaggagggagaacttcaatgatgtttatatcgtttacgagttgatggac
actgatcttcatcaccttctacgatcaaaccagacactaactgatgatcattgtcagtac
ttcgtctaccagctgctccgaggactcaaatatgtgcactcagcaaatgtcttgcacaga
gaccttaggccgagcaatctgctgctgaatgccaaatgtgacctgaagattggggacttt
gggctggcaaggaccacaactgaaactgacttcatgatggagtacgtcgttacacggtgg
tacagagcgcctgaactcctgctcaactgctcagagtatactcaggctattgacatgtgg
tcagtaggctgcatcttcggtgaaatggtcacaagagagcctttgtttcctgggaaggat
tatgttcatcagctgctgctaataactgagctggtaggctcacctgatgacaccagcctt
gggttcctccgaagcgatcacgcccgcagatatgtgaggtcccttcctcaacaccccaag
caacaattccgtgtgcggttccctactatgtctagtggtgccatggatttgcttgagagg
atgctcgtgtttgatccgagcaagaggattactgttgatgaggctctatgccacccatac
ctggcatcccttcatgagataaatgacgaacctgtctgcccagcgcctttcagctttgac
ttcgagcagccatcgctcaccgaagaagatatcaaggaactcatctggagggagtctctc
aagttcaatcctgacccaatccactaa

DBGET integrated database retrieval system