KEGG   Sorghum bicolor (sorghum): SORBI_07g004320Help
Entry
SORBI_07g004320   CDS       T01086                                 

Gene name
SORBIDRAFT_07g004320, Sb07g004320
Definition
hypothetical protein
Orthology
K03505  
DNA polymerase delta subunit 4
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Base excision repair
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
DNA polymerase delta complex
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    SORBI_07g004320 (SORBIDRAFT_07g004320)
   00240 Pyrimidine metabolism
    SORBI_07g004320 (SORBIDRAFT_07g004320)
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SORBI_07g004320 (SORBIDRAFT_07g004320)
   03410 Base excision repair
    SORBI_07g004320 (SORBIDRAFT_07g004320)
   03420 Nucleotide excision repair
    SORBI_07g004320 (SORBIDRAFT_07g004320)
   03430 Mismatch repair
    SORBI_07g004320 (SORBIDRAFT_07g004320)
   03440 Homologous recombination
    SORBI_07g004320 (SORBIDRAFT_07g004320)
DNA repair and recombination proteins [BR:sbi03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     DNA polymerase delta complex
      SORBI_07g004320 (SORBIDRAFT_07g004320)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 133 aa AA seqDB search
MTRGGGGDMKSFFRQQKANAGAGATKPTGGVSKKASPAAAHQHHQKAAPALHVHPSSPDH
GASAGADTGRLQQEEEERERAAREFDMDMRYGPCLGVTRAQRWRRAAALGLAPPPALLAL
CTDDQPCLWEGRV
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgacgaggggcggcggaggcgacatgaagtccttcttccgtcagcagaaggcgaacgcc
ggggccggcgccaccaagcccaccggcggcgtctccaagaaggcttcgccggcggcggcg
caccagcaccaccagaaggccgcgcccgccctccacgtccacccgtcgtccccagatcac
ggcgccagcgccggtgccgacacggggaggctccagcaggaggaggaggagcgggagagg
gcggcccgggagttcgacatggacatgcgctacgggccctgcctcggcgtcacccgcgcc
cagcgctggcgccgcgccgccgcgctcggcctcgcaccgccgccggcgctcctcgccctc
tgcaccgatgaccagccctgcctctgggagggccgcgtctag

DBGET integrated database retrieval system