KEGG   Sorghum bicolor (sorghum): SORBI_07g007640Help
Entry
SORBI_07g007640   CDS       T01086                                 

Gene name
SORBIDRAFT_07g007640, Sb07g007640
Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     SORBI_07g007640 (SORBIDRAFT_07g007640)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 706 aa AA seqDB search
MDSATTSGAMELVAALLRGRVPPELMGGDGAEGRALVATLAAAVLGAALFVLWRRAAAGK
KRKREAAAAAVAEATEVKARAAKGGEDEKAADDGRKKVTVFFGTQTGTAEGFAKALAEEA
KARYDKAIFKVVDLDDYAAEDEEYEEKLKKEKLALFFVATYGDGEPTDNAARFYKWFTEG
NERGVWLNDFEYAVFGLGNRQYEHFNKVAKVVDEILTEQGGKRLVPVGLGDDDQCIEDDF
NAWKEALWPELDRLLRDENDASTGTTYTAAIPEYRVEFIKPEEAAHLERNFSLANGHAVH
DAQHPCQANVAVRRELHTPASDRSCTHLEFDIAGTGLTYETGDHVGVYTENCPEVVEEAE
RLLGYSPDTFFTIHADKEDGTPLSGSSLAPPFPSPITVRNALARYADLLNSPKKTSLVAL
ATYASDPAEADRLRFLASAAGKDEYAQWVVASQRSLLEVMAEFPSAKPPLGVFFAAVAPR
LQPRYYSISSSPSMAATRIHVTCALVHETTPAGRVHKGVCSTWIKNAVPSEESKDCSWAP
IFVRQSNFKLPADPSVPIIMIGPGTGLAPFRGFLQERLAQKESGAELGPSVFFFGCRNSK
MDFIYEDELNNFLEQGALSELVLAFSRQGPTKEYVQHKMAQKASEIWDMISQGAYIYVCG
DAKGMARDVHRVLHTIVQEQGSLDSSKAESFVKNLQMEGRYLRDVW
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggactcggcgacgacgtcgggggcgatggagctggtggcggcgctgctgcggggccgg
gtgccgccggagctgatgggcggggacggcgccgagggccgggcgctcgtcgccacgctc
gccgccgccgtgctcggcgccgcgctcttcgtgctctggaggcgcgccgccgccgggaag
aagcgcaagcgggaggccgccgccgccgccgtcgctgaggccacggaggtcaaggccagg
gccgctaagggcggcgaagacgagaaggcggccgacgacggcaggaagaaggtcaccgtc
ttcttcggcacgcagaccggcaccgccgaggggttcgccaaggcgcttgctgaggaggcg
aaggcaagatatgacaaggcaatcttcaaagttgtggacttggatgattatgcagcagag
gatgaggaatatgaggagaagttgaagaaggagaagctagcattgttcttcgtggcaacg
tatggagatggtgagccgaccgacaatgctgctaggttctacaaatggttcactgaggga
aatgagaggggtgtctggttaaatgactttgagtatgctgtctttggtctgggcaatcga
cagtatgagcatttcaacaaggttgccaaggtggtagatgagatcctaacagaacaaggt
ggaaagcgccttgttccagttggtcttggagacgatgaccaatgcattgaggatgacttc
aatgcatggaaagaagctctctggccagagttggatcgattacttcgggatgaaaatgat
gcctctacaggcactacatacacagctgctattcctgaataccgggttgaattcatcaaa
cctgaggaggcagctcatttggagagaaacttcagccttgcaaatggccatgcagtccat
gatgcccagcatccttgccaggctaatgtggctgtgcggcgggagctccacacccctgct
tctgatcgttcatgcacccatttggagttcgacattgctggaactggtctcacgtatgag
actggggaccatgttggtgtatacaccgagaactgccctgaggttgtagaggaggcagag
aggttgttgggctactcgccagacacatttttcaccatccatgcagacaaagaggatggt
actccactaagtggcagttctcttgctcctccattcccctccccaatcacagtgaggaat
gcacttgctagatatgctgaccttctaaattcaccgaagaagacttctctggttgcatta
gctacttatgcttcagatccggctgaggctgaccgcctgagattcttggcctctgccgct
gggaaggatgagtatgctcaatgggttgtggcaagtcagaggagcctgttggaagtcatg
gcagagttcccttcggcaaagcctccactaggtgtcttctttgcagctgttgcccctcgt
cttcaaccaagatattattctatttcatcttcacctagtatggcagcaaccaggattcat
gtcacatgtgcgctcgtgcacgaaacaacacccgctggaagggtacataagggagtctgc
tcaacttggattaagaatgctgttccatcagaagagagcaaggattgcagctgggctccg
atatttgtgaggcaatcaaacttcaaactacccgctgatccttcagtgccaatcatcatg
attggccctgggaccggtcttgcacctttccgcggcttcttgcaggagagactagctcaa
aaagaatctggagctgagcttggtccatccgtgttcttcttcggatgcagaaatagcaag
atggacttcatctatgaggatgagctgaacaatttccttgagcaaggagcactgtctgag
ctggttcttgccttctcgcgtcagggccctactaaggaatatgtgcaacacaaaatggca
cagaaagcatctgaaatctgggacatgatatcccaaggtgcttacatctatgtctgtggt
gatgccaaaggcatggccagagatgtacatagagttctccacaccattgttcaggagcag
ggctccctcgacagttctaaggccgagagctttgtgaagaatctccaaatggagggcaga
tatctgagggatgtgtggtaa

DBGET integrated database retrieval system