KEGG   Sorghum bicolor (sorghum): SORBI_07g021780Help
Entry
SORBI_07g021780   CDS       T01086                                 

Gene name
SORBIDRAFT_07g021780, Sb07g021780
Definition
hypothetical protein
Orthology
K06268  
serine/threonine-protein phosphatase 2B regulatory subunit
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Protein phosphatases and associated proteins [BR:sbi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Calcineurin (PPP3/ PP2B)
    Regulatory subunits
     SORBI_07g021780 (SORBIDRAFT_07g021780)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 175 aa AA seqDB search
MGSTPSMLTQYDIEEVQDHCDHAFSQQEIVSLYHRFCQLDRNGGGFVSADEFMSVPEFAV
NPLSQRLLRMLDGLNFKEFVAFLSAFSPRTSLQQKIEFIFKVYDTDCNGKVAFDDILSIL
RDLTGSFMTEQQRQKVLTHVLEEAGYTKDSHFTLPDFMKIIGNSELKMEVEVPID
NT seq 528 nt NT seq  +upstreamnt  +downstreamnt
atggggagcactccctctatgctcacccaatatgacatcgaggaggtccaggaccattgt
gaccacgcattctcgcagcaggagatagtttcgctgtaccaccgcttctgccagctcgac
cgcaacggaggtggcttcgtctccgctgacgaattcatgtcggtccctgagttcgccgta
aatcccctctcccagaggctcctgaggatgctggatgggctcaacttcaaggagtttgta
gcatttttgtcggcttttagcccccgcacaagcctgcagcaaaagattgaatttattttc
aaggtttatgatactgactgcaacgggaaggttgcttttgatgacatcttgagcatcttg
cgagatctcacaggttcatttatgacagagcaacagagacagaaagtcttgactcatgtg
ttagaagaagctgggtacacaaaagattcgcatttcacactcccagactttatgaagatt
attggcaattctgagctcaagatggaggttgaagttcctattgactaa

DBGET integrated database retrieval system