KEGG   Sorghum bicolor (sorghum): SORBI_07g023010Help
Entry
SORBI_07g023010   CDS       T01086                                 

Gene name
SORBIDRAFT_07g023010, Sb07g023010
Definition
hypothetical protein
Orthology
K01176  
alpha-amylase [EC:3.2.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    SORBI_07g023010 (SORBIDRAFT_07g023010)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     SORBI_07g023010 (SORBIDRAFT_07g023010)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 443 aa AA seqDB search
MANHLAAGLFGLLLAVAVLCLLIGSNTARAQVLFQGFNWESCKKQGGWYKFLQAQVDDIA
GAGATHVWLPPPSHSVAPQGYMPGRLYDLNASRYGTEAELRSLIAAFRGKGVEAVADIVI
NHRCADKKDGRGVYCIFEGGGGDDGGTGTGRLNWDADMICGDDTEFSNGRGNRDTGKDFG
AAPDIDHLNPRVQRELSDWLCWLSADVGFTGGWRLDFAKGYSAAVAKAYVDRTRPSFVVA
EIWSSLSYDGDGKPKHNQDGDRQELVDWVNAVGGPAAAFDFTTKGVLQAAVQGELWRMRD
GNGKAPGMIGWLPEKAVTFVDNHDTGSTQNSWPFPRDKVMQGYAYILTHPGIPSIFYDHV
FEWNLKQEISTLAAIRKRNGIHPGSKLSIVKAEGDVYVAMIDDKVITKIGTRYDVGSVIP
SGFSVAAHGDGYCIWEKRDYHYH
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atggcgaaccacctggccgccggcctgttcggcctcctcctagctgtcgcggtgctgtgc
ttgcttattggctccaacacggcacgagcccaggtcctgttccaggggttcaactgggag
tcttgcaagaagcaaggcggctggtacaagtttctccaggcgcaggtggacgacatcgcc
ggcgccggcgccacccacgtctggctgccgccgccatcgcactccgtcgcgccacagggc
tacatgccggggcggctctacgacctgaacgcgtccaggtacggcacggaggcggagctg
cggtcgctgatcgccgcgttcaggggcaagggcgtggaggccgtggcggacatcgtcatc
aaccaccggtgcgccgacaagaaggacggccgcggcgtgtactgcatcttcgagggcggc
ggcggcgacgacggcggaacggggacggggcggctcaactgggacgccgacatgatctgc
ggcgacgacacggagttctccaacgggcgcggcaaccgcgacacgggcaaggacttcggc
gcggcgccggacatcgaccacctgaacccgcgcgtgcagcgggagctctcggactggctc
tgctggctcagcgccgacgtcgggttcaccggcggctggcgcctcgacttcgccaagggc
tactccgcggccgtcgccaaggcgtacgtcgacaggacgcggccgagcttcgtggtcgcg
gagatatggagctccctcagctacgacggcgacggcaagccgaagcacaaccaggacggg
gaccggcaggagctggtggactgggtgaacgccgtgggcggccccgccgccgcgttcgac
ttcaccaccaagggcgtgctgcaggcggccgtgcagggggagctgtggcggatgcgggac
ggcaatggcaaggcgcccggcatgatcggctggctgccggagaaggccgtcacgttcgtc
gacaaccacgacacgggctccacgcagaactcgtggccgttcccgcgtgacaaggtcatg
cagggctacgcctacatcctcacccacccagggatcccatccatcttctacgaccacgtg
ttcgagtggaacctaaagcaggagatcagcacgctggcggcgatcaggaagagaaacggg
atccatccggggagcaagctaagcatcgtaaaagcagaaggcgatgtctacgtcgccatg
atcgacgacaaggtgatcaccaagatcgggacgaggtacgacgtcggcagcgtgatcccg
tcgggtttcagtgtcgccgcgcatggcgacggctactgcatttgggagaagagagactac
cactaccactag

DBGET integrated database retrieval system