KEGG   Sorghum bicolor (sorghum): SORBI_07g023330Help
Entry
SORBI_07g023330   CDS       T01086                                 

Gene name
SORBIDRAFT_07g023330, Sb07g023330
Definition
hypothetical protein
Orthology
K11855  
ubiquitin carboxyl-terminal hydrolase 36/42 [EC:3.1.2.15]
Organism
sbi  Sorghum bicolor (sorghum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 998 aa AA seqDB search
MEEEAESSSSAAAALWLAVVALVVVPAVALLVRARWRRAAARREEVRRLARLAAEEAELA
ERESVLAYYSELFPGVVHAAEVPVAPEWGPPPVVVVPGPAAQEEFDAQPQPQPPVGAKGV
CAVCFKPTTFRCKQCKAVKYCSFKCQIAHWRQGHKDDCHPPSVNTRPDDEGKAEQGRAAE
ENVSVGVKQVAEMNKPVVGSETSDAHHNLKSSNDKSKHMPSEAVCTSAEVPGGHQSNSTV
EISQNVPVPVNSSKMGSSIKHAFFVEDGSSTEDLNGVSPCKSQASPNINGHSSFANEEFC
NHSKEHQRAKDASVVEDCSQTSNTREIEDSSIPQAVASVVLETKSSRTPINVELERSKTK
PIRNDRIQSTKPVPSALTVDKATSVRGSCSVTPNPSKIADNLPDRSFKKPSDRSGSTANN
LATSLKKMVRQQTAPKVVRHYPSESTLFPYELFVKLYGKVELNPFGLHNVGNSCYANAVL
QCLMFTRPLTTYLLEGLHSKNCSQKGWCFMCEFEKLIVEGKRRKTALSPTGILSHLHDIG
SSLGPGKQEDAHEFLRYAIDAMQSVCMKEASKGGVIQSMEETTLVQLIFGGYLRSKIKCS
RCHVSSEQCEPMLDLTVEIDGDISSLDEALERFTSTEVLDGENKYHCSRCKSYERAKKKL
TIEEAPNVLTIALKRYQSGKFGKISKAIRFPDTLNMGHYMNPDTDDISPVYSLYAVVVHH
DVMNAAFSGHYVCYVKDTQGKWFKADDSQVKPVSLDNVMSKCAYMLLYARCSPRAPSSVR
QAMGDPAHPKKAKQKVVSGGTTWRGGSLNRHQAGQQHRDQTADDLTHAFDEYRDVPYSPS
DSPSPSESSSLFSNSDAGSHSTVSTDSSESTRNSTSTEEYEYMFGAADQMYSGGSMGGAP
VESDYPTYSRLRSSLNTSSSGREAYSADSSAEHRLQGGWVEGDESPSLLYTDRSNQQWSS
KLTDQYRQLDRSGHDPGETRGGVLSRRPSRDRTAQTFY
NT seq 2997 nt NT seq  +upstreamnt  +downstreamnt
atggaggaggaggcggagtcgtcgtcctcggcggcggcggcgctgtggctggcggtggtg
gcgctcgtcgtggtgccggcggtggcgctgctggtgcgggcccgctggcgccgggccgcg
gcgcggagggaggaggtgcgccgtctcgcgcggctcgcggccgaggaggccgagctcgcg
gagcgggagtccgtgctggcctactactccgagctgttcccgggcgtcgtgcacgccgcg
gaggtgcccgtggcgcccgagtggggcccgccgccggttgtggtggttccaggcccggcg
gcgcaggaggagtttgatgcacagccgcagccccagccgccggtgggggcgaagggggtc
tgtgcggtgtgcttcaagcccaccacgttcaggtgcaagcagtgcaaggccgtcaagtac
tgttccttcaaatgccagatagcccactggagacaaggtcacaaagatgattgccatcca
ccaagtgttaatactaggcccgatgatgaaggaaaggctgaacagggaagagctgctgaa
gagaatgtatcagttggtgttaaacaggttgctgaaatgaacaaaccagttgttggatct
gaaacttctgatgcacaccataatttgaagagttcaaatgataaaagtaaacatatgcct
tcagaagcggtatgtaccagtgcagaggttcctggaggtcatcagtccaacagcacggtc
gaaatttctcaaaatgttccagtgcctgttaacagtagtaagatggggtcaagtatcaaa
catgcattttttgttgaagatggttcttccaccgaggacttgaatggggtctcgccatgt
aagtctcaggcttcaccaaacataaacggtcatagcagttttgcaaacgaagaattctgc
aatcattccaaggaacaccaaagagctaaggatgccagtgttgttgaggattgttctcag
acaagcaataccagagagattgaagacagtagcattccccaagcagttgcatctgttgtt
ttggagaccaaaagttctaggactcctattaatgtggaacttgagaggtctaaaacaaaa
cctattaggaatgatagaattcagagcacaaaacctgtgccatctgcattgactgttgac
aaagccacttcagttcgtgggagttgttctgttacacctaatccatctaaaatagcagat
aatcttcctgatagaagttttaaaaaaccttcagataggtcaggttcaacagcaaataac
cttgcaacatctctgaagaaaatggtcaggcagcaaactgcaccaaaagttgtgaggcat
tatccatcagaatcgacactcttcccatatgaactttttgtgaagctctacggcaaggtt
gagttgaacccttttggtcttcataacgttggcaacagttgctatgcaaatgctgttctt
cagtgcttgatgtttactcgaccactcacaacatatcttttggaaggccttcactcaaaa
aactgttctcaaaaaggatggtgcttcatgtgtgaatttgagaaactcattgtggagggc
aaacggcgcaagactgccttgtcaccaactgggatactctctcatttgcatgacattggc
agtagcttgggtcctggtaaacaagaagatgctcatgaatttcttaggtatgcaattgat
gctatgcaatccgtatgcatgaaggaagctagcaaaggaggtgttattcagtcaatggaa
gaaacaactcttgtgcaattgatatttgggggctatctgcgatctaagatcaaatgttca
aggtgccacgttagttctgaacaatgcgagcccatgttggatcttactgttgaaatagat
ggtgacattagttcgctcgatgaggcacttgagcggtttacatccacagaagtcttggat
ggagaaaacaaatatcactgcagcagatgcaaatcctatgagcgtgctaaaaagaagctg
acaatagaggaagcgccgaatgttctgactattgcactgaaaagatatcagtctggcaag
tttggaaagatcagcaaagccatcagatttccagacaccctcaatatgggtcactatatg
aacccagatactgatgacatatcgccagtttacagcctctatgcagttgtcgtccatcat
gatgtcatgaatgctgccttctctggtcattatgtatgttatgttaaagatacacaggga
aagtggtttaaggcagacgacagtcaggtgaaacctgtatctctggacaatgttatgtca
aagtgtgcatatatgttgctgtatgcaaggtgttcaccgagggcaccaagctctgttagg
caggctatgggggacccagcacaccccaagaaggccaaacagaaggtggtttcaggagga
acaacatggcgaggaggttccttaaacaggcaccaagctggtcagcagcatagagaccag
acggcagatgaccttacccatgcgtttgacgaatatagagatgtaccatattcgccttca
gattctccgagtcctagcgagagttcatccctcttcagcaactcggacgcagggtcgcac
agcactgtcagcaccgacagcagcgagagcacaaggaactcgaccagcaccgaggagtat
gagtacatgttcggagctgctgatcagatgtactcaggaggctccatgggaggagcacct
gtggagagtgactatccgacgtattcccgtttgaggtccagcttgaataccagctcatca
ggccgggaggcatacagtgcggatagctctgcggagcacaggcttcagggcggttgggtt
gagggcgatgagagcccgtccttgttgtatactgacagaagtaatcagcagtggagcagt
aagttaacagaccagtataggcagttagataggagcggacatgaccctggagaaaccagg
ggcggtgtcttatcgagaagaccatctagggacaggaccgcccaaacattttattga

DBGET integrated database retrieval system