KEGG   Sorghum bicolor (sorghum): SORBI_07g023880Help
Entry
SORBI_07g023880   CDS       T01086                                 

Gene name
SORBIDRAFT_07g023880, Sb07g023880
Definition
hypothetical protein
Orthology
K05610  
ubiquitin carboxyl-terminal hydrolase L5 [EC:3.4.19.12]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.19  Omega peptidases
    3.4.19.12  ubiquitinyl hydrolase 1
     SORBI_07g023880 (SORBIDRAFT_07g023880)
Peptidases [BR:sbi01002]
 Cysteine Peptidases
  Family C12: ubiquitin C-terminal hydrolase family
   SORBI_07g023880 (SORBIDRAFT_07g023880)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 331 aa AA seqDB search
MSWAAIENDPGVFTELLQQMQLKGLQVDELYSLDLDALSDLQPIYGLIVLYKWRPPEKDE
RPVIKDAIPNLFFANQIINNACATQAILSVLLNSPGITLSDELKKLKEFAKDLPPELKGL
AIVNCASIRMLNNSFARSEVSEEQKPHSKDDDVYHFISYVPVDGVLYELDGLKEGPISLG
KCPGGIGDAGWLRLVQPVIKEHIDMFSQNEIRFSVMAILKNRKEMFTVELKDLQRKRESL
LQQMGDPSAIRHVPSVEQSLAEVAAQIESVTEKIIMEEEKSKKWKTENLRRKHNYVPFLF
NFLKILEEKQQLKPLIEKAKAKQKSHGPSAR
NT seq 996 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtgggccgcaatagagaatgatcctggtgtttttacagaactgttgcagcagatg
caactgaagggtcttcaagtcgatgaactctactcacttgacctggatgctctcagtgat
cttcagccaatctatgggctaatagtgctatacaaatggcgacctccggaaaaggatgag
cgtcctgtcatcaaggatgcaatcccaaaccttttctttgccaaccagataattaacaac
gcttgtgcaacccaagctatcctttcagttctcttgaactctcctggcatcacccttagt
gatgagcttaaaaagctgaaggaatttgcaaaggatttgccacctgagctcaaaggattg
gctatagtcaattgtgcaagcattcgcatgctaaacaactcgtttgcaaggtcagaggtc
tctgaggagcagaaaccacatagcaaggacgacgatgtataccatttcataagctatgtt
ccagtggatggcgtcttgtatgagcttgatgggctaaaggaaggaccaataagcctggga
aaatgcccaggtggtattggtgatgcagggtggcttaggctagtgcaacctgtgattaaa
gagcacattgacatgttctctcagaatgagataagattcagtgtgatggcaatcttaaag
aaccggaaggagatgttcacagtggagctcaaagaccttcagaggaagagggagagcctc
ttgcaacagatgggtgacccttctgcgatcaggcacgtgccatctgttgagcagtcgcta
gcggaggtggcagctcagatcgagtctgtgacagagaagatcataatggaggaagagaag
tcgaagaagtggaagacggagaacttgaggaggaagcataactacgtgccgttcctgttc
aatttcctcaagattcttgaggagaagcagcagttgaagcccctgatagagaaggcaaag
gcgaagcagaagtctcacggcccaagtgctaggtga

DBGET integrated database retrieval system