KEGG   Sorghum bicolor (sorghum): SORBI_07g024410Help
Entry
SORBI_07g024410   CDS       T01086                                 

Gene name
SORBIDRAFT_07g024410, Sb07g024410
Definition
hypothetical protein
Orthology
K00573  
protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     SORBI_07g024410 (SORBIDRAFT_07g024410)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 232 aa AA seqDB search
MEHHGLWSSGASDKNKSMVEQLQRYGVIRSTKVAEVMEAIDRGLFVPPGGTPYHDSPMPI
GYNATISAPHMHAACLELLEKNLQPGMRALDVGSGTGYLTACFALMVGPEGRAVGVEHIP
ELVATSIENIKKSAAAPQLNDGSLSIHVADGREGWPELAPYDAIHVGAAAPQIPEALIEQ
LKPGGRMVIPVGTVFQELKVVDKKLDGTVGIRDETSVRYVPLTSKESQLHAR
NT seq 699 nt NT seq  +upstreamnt  +downstreamnt
atggagcatcatggcctgtggtccagcggggccagcgacaagaacaagtccatggttgag
cagctccagaggtacggggtcatcaggtcgaccaaagtcgcggaggtgatggaggccatc
gacagggggttgttcgtgccacctgggggcacgccgtaccacgacagccccatgccgatt
gggtacaatgccacgatatcggcgccacacatgcacgccgcttgcctggagctcctggag
aagaatcttcagcctggaatgcgagctctcgatgttgggtcaggcactggatacctaact
gcttgctttgcactgatggttggaccagaaggacgagcagttggtgttgaacacatccca
gagttggttgctacttctattgagaacatcaagaaaagtgcagcagccccacagctaaat
gatggatccctcagtatacacgttgctgatgggagggaaggttggccagagctggcaccc
tatgacgccatccatgttggagctgcagcaccgcagatcccagaggcgctgatagagcag
ctgaagcccggcggcagaatggtgatccctgtcgggacagtcttccaggagctgaaggtt
gtggacaagaagttggatggcacggtcggcataagagacgaaacgtctgtgcgctatgtg
cccctcactagcaaggaatctcaattgcacgcaagatga

DBGET integrated database retrieval system