KEGG   Sorghum bicolor (sorghum): SORBI_07g025750Help
Entry
SORBI_07g025750   CDS       T01086                                 

Gene name
SORBIDRAFT_07g025750, Sb07g025750
Definition
hypothetical protein
Orthology
K13728  
mitotic spindle assembly checkpoint protein MAD2B
Organism
sbi  Sorghum bicolor (sorghum)
Module
DNA polymerase zeta  complex
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
7
AA seq 205 aa AA seqDB search
MDRKNQTPQGQIARVVVEFLEVAVSCIIFLKGFYPPRAFERRRYMNVVVQKARHPELASY
IHSVTVGLLPFIQKGLVERVVVIFYDKEHVPIEKFVFKLAVNQSYCSKLEEANLEFALRA
FLIKLTVAEPVTKPLPSDGNWEITAYFRSLPGDDDREAQLWIPTDTKLWMQPPQITPIKS
VSCDPLKMQLYLEHPSITEPKDPAA
NT seq 618 nt NT seq  +upstreamnt  +downstreamnt
atggatcggaagaatcaaactcctcaaggtcaaatagcacgggtggttgtggaatttctt
gaggtagcagtcagctgcatcatcttcctcaaaggcttctatcctcctcgtgcctttgag
aggagaaggtatatgaatgtagtggtccagaaagcacggcatcctgaacttgctagctat
attcactctgtgactgtcggccttcttcctttcattcagaagggattggtagagagggtt
gtggtcatcttctatgacaaagagcatgtaccaattgagaagtttgtcttcaagcttgca
gtcaaccaatcatattgttccaagttagaggaggcaaacctggagtttgctctgcgagca
ttcttgatcaagctgactgttgctgagcctgttaccaaaccccttccatcagatggtaac
tgggagatcactgcctacttccggtccctccctggcgatgacgaccgagaagctcagctg
tggattcctacagacaccaagctgtggatgcagcctccgcaaattacccctatcaagtca
gttagctgtgaccctctgaagatgcagctttacttggagcaccctagcatcacagaaccg
aaggatccggcagcataa

DBGET integrated database retrieval system