KEGG   Sorghum bicolor (sorghum): SORBI_08g000480Help
Entry
SORBI_08g000480   CDS       T01086                                 

Gene name
SORBIDRAFT_08g000480, Sb08g000480
Definition
hypothetical protein
Orthology
K04646  
clathrin heavy chain
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:sbi04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 1163 aa AA seqDB search
MMSQMEGGCPVDYNTITDLFLQRNMIREATAFLLDVLKPNLPEHAFLQTKVLEINLVTYP
NVADAILANGMFSHYDRPRIAQLCEKAGLYLRALQHYSELPDIKRVIVNTHAIEPQALVE
FFGTLSREWALECMKDLLLVNLRGNLQIVVQAAKEYSEQLGVDACIKLFEQFKSYEGLYF
FLGSYLSSSEDPDIHFKYIEAAARTGQIKEVERVTRESNFYDAEKTKNFLMEAKLPDARP
LINVCDRFGFVPDLTHYLYTNNMLRYIEGYVQKVNPGNAPLVVGQLLDDECPEDFIKGLI
LSVRSLLPVEPLVDECEKRNRLRLLTQFLEHLVSEGSQDVHVHNALGKIIIDSNNNPEHF
LTTNPFYDSRVVGKYCEKRDPTLAVVAYRRGQCDDELINVTNKNSLFKLQARYVVERMDG
DLWDKVLQPENEYRRQLIDQVVSTALPESKSPEQVSAAVKAFMTADLPHELIELLEKIVL
QNSAFSGNFNLQNLLILTAIKADPSRVMDYINRLDNFDGPAVGEVAVEAQLYEEAFAIFK
KFNLNVQAVNVLLDNIRSIERAEEFAFRVEEDAVWSQVAKAQLREGLVSEAIESFIRADD
AAHFLDVICAAEEANVYDDLVKYLLMVRQKAREPKVDGELIFAYAKIDRLSEIEEFILMP
NVANLQNVGDRLYDEELYEAAKIIYAFISNWAKLAVTLVKLKQFQGAVDAARKANSAKTW
KEVCFACVDAEEFRLAQICGLNIIVQVDDLEEVSEYYQNRGCFNELIALMESGLGLERAH
MGIFTELGVLYARYRPEKLMEHIKLFSTRLNIPKLIRACDEQQHWKELTYLYIQYDEFDN
AATTIMNHSPDAWDHMQFKDVCVKVANVELYYKAVHFYLQEHPDLINDMLNVLALRLDHT
RVVDIMRKAGQLHLVKPYMVAVQSNNVSAVNEALNELYVEEEDYERLRESVDMHDNFDQI
GLAQKLEKHELLEMRRIAAYIYKKAGRWKQSIALSKKDNMYKDCMETCSQSGDRELSEDL
LVYFIEQGKKECFASCLFICYDLIRPDVALELAWMNNMLDFAFPYLLQFIREYTSKVDDL
VKDKIESQKEERAKEKEEKDLVAQQNMYAQLLPLALPAPPMPGMGGPPPPMGGMGMPPMG
GMGMPPMGPGPMPAFGMPPMGSY
NT seq 3492 nt NT seq  +upstreamnt  +downstreamnt
atgatgtcacaaatggagggaggctgcccagtagattataatacaataactgaccttttc
cttcagagaaatatgatacgggaggcaacagcttttctgttggatgttctgaaaccaaac
ttgccagagcatgcttttcttcaaaccaaggttttggagataaacttagtgacttacccg
aatgttgctgatgccattcttgctaatggtatgttcagtcattatgaccgccctcgtatt
gctcagctgtgtgaaaaggctggtttgtacttgcgagccctccagcattactcagagttg
cctgatatcaagcgtgtcattgtaaatacccatgccattgagccacaggcacttgttgag
ttctttggcaccttgtcaagagagtgggctttggagtgcatgaaagacctcctactggtt
aacctgaggggaaatcttcagattgttgtgcaggctgcaaaagaatactctgaacagcta
ggggttgacgcttgcattaaattatttgagcaattcaaatcttatgagggcctttacttt
ttcttgggatcctatctgagctccagcgaggacccagatatccatttcaagtacatagaa
gcagctgcaaggactggacagatcaaagaagttgaacgtgtaaccagagagtcaaacttc
tatgatgctgagaagacaaagaactttttgatggaagcaaaactacctgatgcccgtcca
ctgattaatgtttgtgaccgctttggttttgtgccagatctcactcactatctgtataca
aacaacatgcttcgatatatcgaaggctatgttcagaaggtgaatcctgggaatgctcca
ttggtagtggggcaactacttgacgatgagtgccctgaagattttatcaagggtttgatt
ctctctgttcgttctctccttcctgttgagccactggttgatgaatgtgagaagaggaac
cgcctacgtttgctcactcaattcttggagcacttagtgagtgaaggtagccaagatgtg
catgtccataatgctcttggcaaaatcatcattgacagcaacaacaatcctgagcatttc
cttactaccaatccattttacgactctcgtgttgtgggtaaatattgtgaaaagcgggat
cctacacttgctgttgttgcttacagacgtgggcagtgtgatgatgaacttattaatgtc
actaacaaaaactctttattcaagctacaagctaggtatgtggttgagagaatggatggt
gatctgtgggataaagttcttcagcctgagaatgaatatagaaggcaactcattgaccaa
gtggtttcgactgcattgcctgagagcaagagccctgagcaagtttctgcggctgttaag
gctttcatgactgctgacctgcctcatgaacttattgagcttcttgaaaagattgttctt
cagaattctgctttcagtggaaatttcaatctgcagaacctgctcatcttgactgctatc
aaggcagatccatccagagtcatggactatatcaacagacttgataactttgatgggcct
gctgttggagaagttgctgttgaagcacagctgtatgaggaggcttttgctatattcaag
aagttcaacttaaatgtgcaggctgtcaatgttctcttggacaacatccggagcatagaa
agagctgaggaatttgctttccgtgttgaagaagatgctgtgtggagccaggttgccaaa
gcccagttacgtgaaggtctggtcagtgaagcaattgagtccttcattcgcgcagatgat
gctgcacatttccttgatgttatctgtgctgccgaggaagctaatgtgtacgatgattta
gtaaagtaccttctgatggtaaggcaaaaggcacgggaacccaaagttgatggagaactc
atctttgcatatgctaagattgacaggctcagtgaaattgaggaattcattcttatgcca
aatgttgccaaccttcaaaatgttggtgaccgcctgtatgatgaagaactatatgaagct
gcaaagatcatctatgctttcatctcaaactgggctaagctggctgttaccctggttaag
ctgaagcagttccaaggtgctgtggatgctgctcgcaaggctaacagtgccaaaacatgg
aaggaggtctgctttgcttgtgttgatgccgaggagttccgtcttgcacaaatatgtggt
ctcaatattattgttcaggttgatgacttggaagaagtcagtgaatactaccagaataga
ggatgtttcaatgagcttattgctctcatggagagtggtcttggacttgaacgtgcacac
atgggcatcttcacagaattgggagttctatatgctagataccgccctgagaagcttatg
gagcacatcaaacttttctccacccgtctcaatattcctaagcttatccgggcttgtgat
gaacagcagcactggaaagaacttacctacctgtacatacagtatgacgaatttgacaat
gctgccaccactattatgaaccactctccagatgcatgggatcatatgcagttcaaggat
gtctgcgttaaagttgcaaatgtcgagctgtattacaaggcagttcacttctatttgcaa
gagcatcctgatctcatcaatgatatgctaaacgtgcttgcacttcggttagatcatacc
cgagttgtagacataatgcgcaaggctggtcagttgcatctagtgaaaccgtatatggtt
gcagttcagagtaacaatgtctctgctgtgaatgaagccttgaatgagctttatgttgaa
gaggaagactatgagagactccgtgaatcagttgacatgcatgacaactttgaccagata
ggtcttgcccagaagcttgagaagcatgaattgctggagatgcggaggattgccgcctac
atttacaagaaggctggcaggtggaagcaatccattgctctatccaagaaagacaacatg
tacaaggattgcatggagacatgctcacaatctggtgaccgtgaactgtcagaggacttg
cttgtctatttcattgagcagggtaagaaagaatgctttgcttcctgcctcttcatttgc
tacgacttgatccggccagatgtcgctcttgagcttgcatggatgaacaacatgttggac
tttgccttcccatacctgttgcagttcatccgtgaatacactagcaaggttgatgattta
gtgaaggacaaaattgagtcgcagaaggaagaaagagccaaagagaaggaggagaaagat
cttgtggctcagcagaacatgtacgcccaactgcttcctcttgctttgcccgctccgcca
atgcctggcatgggcggccctccacctccgatgggtggaatgggcatgcctccaatgggt
ggaatgggtatgccgccaatgggccctggtccgatgccagcatttgggatgccgccaatg
ggaagctactga

DBGET integrated database retrieval system