KEGG   Sorghum bicolor (sorghum): SORBI_08g000910Help
Entry
SORBI_08g000910   CDS       T01086                                 

Gene name
SORBIDRAFT_08g000910, Sb08g000910
Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
sbi  Sorghum bicolor (sorghum)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 1368 aa AA seqDB search
MALGDLMASRLVHSSSSSPSPSPLRSTAAAAAPAPAPPLPNHHHHNHNQNHNHAGDGLLA
ANGPEPRNGVEAAAEVEKPAPVAYLPQVVVLCEQRHEPEGIDEAAAAAAAPSTSGLVSKW
RPKDRMKTGCVALVLCLNISVDPPDVIKISPCARTECWIDPFSMAPPKALDTIGKTLHSQ
YERWQPKARYKLQLDPTVEEVKKLCNTCRKYARSERVLFHYNGHGVPKPTSNGEIWVFNK
SYTQYIPLPITDLESWLKTPSIYVFDCSAAGIIVKAFLERLDWSSSSSSSAQKDCILLAA
CEAHQSLPQSEEFPADVFTACLTTPIKMALHWFCKRSLLRGSLDLSLIDQIPGRQNDRKT
LLGELNWIFTAITDTIAWNVLPHDLFQRLFRQDLLVASLFRNFLLAERIMRSASCSPVSY
PLLPPTHQHHMWDAWDMAAEICLSKLPELIADPNVEFQPSPFFTEQLTAFEVWLDHGSED
KKPPEQLPIVLQVLLSQSHRFRALVLLGRFLDMGPWAVDLALSVGIFPYVLKLLQTSAME
LRQILVFIWTKILSLDKSCQVDLVKDGGHAYFVRFLDSLDAYPEQRAMAAFVLAVIVDGH
RTGQEACMNAGLIDVCLRHLQPENPHDSHTEPLLLQWLCLCLGKLWEDFPDVQLLSLQTN
TPEIVICLLSGPQPEVRAAAVFALGTLLDTTSNGADDDSDDDEKVKAEINIVRSLLQISS
DASPLVRSEVAIALTRFALGHNKHLKSVAAEYWKPQSNSLLKSLPSLANISNPSNVYSPN
NILQGSIGPVLRVGSDSSAAGRDGRISTSSPIATSSIMHGSPQSDDSSQHSDSGILLREN
ASNGGLGYTRSRPVDNVIYSQFISTMCSFAKDPYPRIATIGRRALSLIGVEQVVMKNTRF
NSGGAHRGETSASNFGMARSSSWLDMNSGSNLIKFRTPPVSPPQHDYLPGLRRVCSMEFG
QHPINSPDGLADPLLSSAAAPSNAELSILPQSTIYNWSCGHFSRPLLTGSDDNEEANARR
EERERVALDYIAKCQRSSCKMTSQIASWDTRFELGTKAALLLPFSPIVVAADENEQIRVW
NYDDALPVNSYQNHNLSDRGLSKLLLINELDESLLLAASSDGNVRVWKNFAQKGGQKLVT
AFSSVQGHRAAGRSIVIDWQQQSGYLYASGDMSSIFVWDLDKEQLLSTIQSSGDSAISSL
TASQVCSGHFAAGFADGSVRIYDVRSTDRVVYMARPHSPRTEKVVGIGFQPVFDPYKIVS
ASQAGDIQFLDVRRAAEPYLTIEAHRGSLTALAVHRHAPVVASGSAKQMIKVFSLEGEQL
TIIRYQPSFMGQRIGSVNCLSFHPYKSLLAAGAGDNALVSIYAEENYK
NT seq 4107 nt NT seq  +upstreamnt  +downstreamnt
atggcattgggagatctcatggcgtccaggctcgtccactcctcctcgtcctcgccgtcg
ccgtcgccgttgcggtcgacggcggcggccgcggccccggccccggcgccgccgctgccc
aatcaccaccaccacaaccacaaccagaaccacaaccatgccggggatggcctcctggcc
gccaacgggccggagcccaggaacggggtggaagcagcggccgaggtggagaagccggcg
cccgtggcatacctgccgcaggtggtcgtgctgtgcgagcagcgccacgagcccgagggg
atcgacgaggctgcggcggccgccgcagcgccctccaccagcggcctcgtctccaagtgg
cgccccaaggaccggatgaagacgggatgtgttgcacttgtattatgtttaaacataagt
gtggatccacctgatgtaattaaaatttccccttgtgcaagaacggagtgctggatagat
cctttttctatggcacctcctaaagcccttgatactattggaaaaacgttgcattcacag
tatgagcgctggcaacctaaggctcgatacaagcttcagctggacccaacagtggaggaa
gttaagaagctttgcaatacttgccgcaaatatgccagatcagagagagttcttttccat
tataatggccatggcgtaccaaagcctacatctaatggtgagatttgggtgtttaacaag
agttacacacagtatattccacttccaattactgatcttgagtcatggctaaagacacct
tccatttatgtttttgattgctcagcagctggaattattgtgaaagcttttctagagcgc
ctagactggagttcaagctcctcttcatctgcacagaaggactgcattcttcttgctgcc
tgtgaggcacaccaaagtcttcctcagagtgaagaatttcctgctgatgtgtttacggct
tgcctcacaacacccatcaaaatggctttgcactggttttgtaaacgatcattactccgt
ggttctctggatctttctcttattgaccaaattcctggaaggcaaaatgaccgtaaaact
cttcttggggagctcaattggatttttactgctataacagatacaattgcatggaatgtt
cttcctcatgatctcttccaaaggcttttcaggcaagatcttcttgttgctagtctcttt
cgtaacttcttgcttgctgagagaatcatgcgatcagcaagttgttctccagtttcttat
ccgttgttacccccaacacatcaacaccatatgtgggatgcatgggacatggctgctgag
atttgcctttccaagcttcctgagttaattgctgatccaaatgtggagtttcagccaagt
ccgttttttacggaacaactgacggctttcgaagtgtggcttgatcatggctccgaggac
aagaaacctcctgaacagttacccatagttcttcaggtactgcttagtcaatcacacaga
tttagagcgcttgttctgcttggaagatttcttgacatggggccatgggctgttgatttg
gccctgtctgtcggaatatttccttatgtactcaaactgcttcaaacaagtgcaatggag
ttgcgtcaaattcttgtgtttatatggaccaaaattctctctcttgataagtcgtgccag
gttgacctggttaaagatggaggacatgcatattttgttaggtttcttgacagtttggat
gcttacccagaacagcgtgcaatggctgcttttgttttagcagtcattgtggatgggcat
aggacgggtcaagaggcttgtatgaatgcaggccttatagatgtttgcctgagacaccta
caacctgagaatcctcatgattcacatacagaacctttacttttacagtggctttgctta
tgccttgggaaactctgggaagatttccctgatgttcagctacttagtttgcaaacaaat
acaccagaaattgtaatatgtttattgtcggggcctcaacctgaggtcagagctgctgct
gtttttgcacttgggactctcctggatactacatcaaatggcgctgatgatgattctgat
gatgatgaaaaggtgaaagctgaaataaatatagttcgaagccttctgcagatatcttca
gatgctagtccccttgttcgatctgaggttgctatagcgcttactcgctttgcgttgggt
cacaacaaacatctcaaatctgttgcggctgagtattggaaacctcaatccaattcattg
ctgaagtcactaccatcattggcaaatataagtaatccaagcaatgtttacagtcccaac
aatattctacaaggcagcattggtcctgtgctgagggttggcagtgatagcagtgccgct
ggtcgtgatggaagaatttctacaagtagcccaattgcaacaagtagcatcatgcatggc
tctccccagtcagatgattcttcccaacactctgattctggtatattactgagagagaat
gctagtaatggtggtctcggctacactaggtcaaggcctgttgataatgtcatttattct
caatttatatcaactatgtgttcttttgctaaagatccttacccaagaattgcaactatt
ggtcggagagcactgtcccttataggtgttgaacaagtagtcatgaaaaatactagattt
aacagtggaggtgcacatcgaggagagacatctgcttcaaactttggaatggcacgctct
tcgtcctggcttgatatgaattctggaagcaacttgataaaatttaggacccctcctgtt
agcccccctcagcatgattatcttccaggattacgccgagtgtgttctatggagtttgga
caacatcctataaattcacctgatggcttagctgatccccttttaagctccgctgcagct
cccagtaatgctgaactaagtatacttccccaatcaacaatttacaactggagttgtggt
cacttctctaggcctcttttaactggctctgatgataatgaagaagcaaatgctagaagg
gaagagagagaacgagttgcactagattatattgctaagtgccagcgctcctcttgcaag
atgacaagccaaattgctagttgggatacgagatttgagttgggaacaaaagcagcttta
ttgttgccattttctccaatcgttgttgcagctgacgaaaatgagcaaataagagtgtgg
aactacgacgatgcgctgccagtgaactcttatcaaaaccacaatttgtcagacagaggg
ctatccaaacttttgttgatcaatgagcttgatgagagcttgcttttagctgcctcaagt
gatggaaatgtacgtgtatggaaaaattttgctcaaaagggaggacagaaacttgtaacg
gctttctcatcagttcagggacatcgagctgctggtcgcagtattgtgattgattggcag
cagcaatctggttatctttatgcatctggtgacatgtcttccatctttgtatgggatctt
gacaaggaacaacttctcagcactattcagtcatctggtgatagtgccatttcttcactg
actgcatctcaggtctgctctggacattttgctgctggttttgctgatggttctgtcagg
atatatgacgttcgctctactgatagggttgtctatatggccaggccacattcaccaaga
acagaaaaggttgtaggcatagggtttcaacctgtgtttgatccatacaagattgtaagt
gcatctcaagctggagacattcagtttctcgatgttagaagggcagcagaaccctacctg
actattgaggcacacaggggttcacttacggcattagcggttcatcggcatgccccagtt
gttgctagtggctcagccaagcagatgatcaaagtgtttagtcttgaaggagagcagttg
acaataattcgctaccagccatcttttatgggccaaagaataggcagtgtaaactgcctt
tctttccacccatacaaatcactcctagctgctggtgctggtgataacgcccttgtctct
atctacgctgaggaaaattacaagtaa

DBGET integrated database retrieval system