KEGG   Sorghum bicolor (sorghum): SORBI_08g001570Help
Entry
SORBI_08g001570   CDS       T01086                                 

Gene name
SORBIDRAFT_08g001570, Sb08g001570
Definition
hypothetical protein
Orthology
K11420  
euchromatic histone-lysine N-methyltransferase [EC:2.1.1.43]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Lysine degradation
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Amino acid metabolism
   00310 Lysine degradation
    SORBI_08g001570 (SORBIDRAFT_08g001570)
Enzymes [BR:sbi01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     SORBI_08g001570 (SORBIDRAFT_08g001570)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 728 aa AA seqDB search
MENSQDESESDEQEEFLEKKPLRSLAPMFPLPMGYDVATQSTDPLLIFVTPFRPCTSPEQ
SPASFGQPLPKSPIPLKATPISAAFPMPQHKGGSSHDPLKETPMSAAFPMPGPKDEPSDD
PLKATPISAAFPTRRHKDDPLKATPMSRSFPITRHEDESSDEDYKPFSGQKKSTPLKTAK
RTQQAECSNAGNTKRRSIQRSLNRELAFSSSLSSNPNESVEEVMIMFDSLRRRILQLDEN
EDAGKRADLKAGSLMMQNGLRINNSKIIGPVPGVEIGDIFFFRIEMCIVGLHAPAMAGID
HTSAKHAGKDEILAVSIISSGGYENDDNDTDILVYTGQGGNSRRKDKHDQKLEGGNLALM
NSMKKKNLIRVVRSAQDPFCNSSKVYIYDGLYRVEESWTEKAQNGFSVFKYKMRREPGQR
DGISVWKMTEKWKANPATRNNVIRADISSKAEKLPVCLVNDVDDQKGPSYFNYVTGVEHS
GPLRKTKPLQSCKCPSVCLPSDTNCSCAQLNSGYLPYSANGVLVKHIPMLYECSSTCQCC
QNCRNRVTQKGVNLNFEVFWTGDSGWGVRSWDPIRAGTFICEYAGQIIDETNMNMGDEED
EYTFCTSWHSDKVSRWNLGAELLEEKSDNATTENLKKLPVVISAKRSGNVARFLNHSCSP
NVLWQPVQYDHGDDSYPHIMFFAMKHIPPMTELTYDYGTRGAPPGIKGKFPNACKLKKCL
CGKRGLMH
NT seq 2187 nt NT seq  +upstreamnt  +downstreamnt
atggagaactcacaagatgaatcagaaagtgacgagcaagaagaattcttggaaaagaag
ccattgcggtcattagcaccaatgttcccgcttcctatgggatatgatgtggcaactcaa
tcaactgatccattgctaatttttgtcacaccattcaggccctgcacatcgccagaacag
tctccagcttcatttggtcaacccttaccaaagtcaccaattcctctcaaggctactcca
atctcagctgcatttcccatgccacaacacaaaggtggatcgtcacatgatcctctgaag
gaaactccaatgtcagcggcatttcccatgccaggacccaaagatgaaccatcagatgat
cctctcaaggctactccaatctcagctgcatttcccacgcgacgacacaaagatgatcct
ctcaaggctactccaatgtcaaggtcatttccaataacacgacatgaagatgaatcatca
gacgaagactacaaacccttttctggtcagaaaaaatcaaccccgctgaagacagccaag
aggactcagcaggctgaatgctccaatgcaggtaacaccaagcgcaggtcaatacagaga
agcctgaacagagagcttgccttcagttcatccttgtcaagcaacccaaatgaatctgtc
gaagaggtgatgataatgtttgattcacttcggcggcgcatactgcaattggatgaaaat
gaggacgcaggcaagcgggccgacttgaaggctggaagtctcatgatgcagaatggcctg
aggatcaacaattcgaagatcataggacctgtacctggtgttgaaattggagacattttc
ttcttcaggattgaaatgtgcattgttggtttacatgcacctgccatggctggcattgat
cacacctctgctaagcatgctggaaaagatgagattctggcggttagcatcatctcatct
ggtggttatgagaatgatgacaatgacacggacattttggtgtacacaggtcagggaggc
aatagtcggcgcaaggataagcatgaccagaaacttgaaggaggtaaccttgctctcatg
aatagtatgaaaaagaaaaacctaatcagggttgtgcgcagcgcacaggaccctttctgc
aactcgagcaaagtttacatctatgatggactttaccgggtcgaagaatcctggacagaa
aaagcacagaatggttttagtgttttcaagtacaagatgagaagggagccgggacagaga
gatggaatttcagtttggaagatgactgagaagtggaaagcaaatcctgcgacaagaaac
aatgttataagggcagatatatcgtcaaaagctgagaagctacctgtatgccttgttaat
gatgtagatgaccagaaagggccaagctacttcaactatgttactggagtggagcattca
gggccactcaggaagacaaaacctttacaaagctgcaagtgtcctagtgtgtgcttgcct
agtgatactaattgctcatgtgcacaactgaacagtggttatcttccttacagcgccaat
ggagtgcttgtgaagcacattccaatgctttatgagtgctcctccacgtgccagtgttgt
caaaattgtcgaaacagggtcacacagaaaggtgtcaatcttaactttgaggtcttttgg
actggggattccggatggggtgtccggtcctgggacccaatccgtgctggcacattcatc
tgtgagtatgccggtcaaatcattgatgaaacaaatatgaacatgggtgatgaggaagat
gaatataccttttgcacatcatggcacagtgacaaggtttcaagatggaatttgggagca
gaattacttgaagaaaaaagtgataatgccacaacagagaatctgaagaagctgcctgtt
gtcataagtgcaaaacgttcaggaaatgtggctcgttttctgaatcatagctgttccccg
aacgtcctttggcagcccgtgcagtatgaccatggcgatgacagttacccacatatcatg
ttttttgcgatgaaacatattcctcccatgactgaactgacgtatgattatggtacaaga
ggagctcctcctggcattaaggggaagtttccaaatgcttgcaaactcaagaaatgctta
tgtggcaagcgtggactaatgcactaa

DBGET integrated database retrieval system