KEGG   Sorghum bicolor (sorghum): SORBI_08g004300Help
Entry
SORBI_08g004300   CDS       T01086                                 

Gene name
SORBIDRAFT_08g004300, Sb08g004300
Definition
hypothetical protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    SORBI_08g004300 (SORBIDRAFT_08g004300)
Enzymes [BR:sbi01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     SORBI_08g004300 (SORBIDRAFT_08g004300)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 422 aa AA seqDB search
MPLPPLLPAMASTFSPTSAARALLPASTSRPLFLAAASSGRIQPSRKGLDFRRGRFTVCN
VAAPTAAEQEATASSAAKESQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGT
GKSTTVRSLVDLLPDIRVVVGDPFNSDPDDPEVMGPEVRERVLRGDAGLPVTTAKITMVD
LPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSA
ASGWNTVEREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIV
EERARFDRDPKTFRESYNEEQEKLQQQISSARSNLGAVQIDHDLRVKISKVCSELNVDGL
RGDIVTNRAAKALAALKGRDSVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEV
FS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccccttcctcctctcctccccgccatggcttccaccttctcccccacttccgccgcg
agggccctcctcccggcctccacctcccgcccactcttcctcgccgcagcttcctcaggt
cgcattcaaccatccaggaaggggctggacttccgccgcggccggttcaccgtctgcaat
gtcgccgcccccaccgccgccgagcaggaggcgacggcgtcgtcggccgcgaaggagagc
cagcggcccgtgtacccgttcgcggccatcgtggggcaggacgagatgaagctctgcctg
ctgctcaacgtcatcgaccccaagatcggcggcgtgatgatcatgggcgacaggggcacg
ggcaagtccaccaccgtgcgctccctcgtcgacctgctcccggacatccgcgtcgtcgtc
ggcgaccccttcaactccgacccggacgacccagaggtgatggggcctgaggtccgcgag
cgggtgctgcgtggggacgccggcctccctgtcaccaccgccaagatcaccatggtcgac
ctgcccctcggcgccaccgaggaccgcgtctgtggcaccatcgacatcgagaaggcgctc
accgagggcgttaaggcgttcgagcccggcttgctcgccaaggccaacaggggcatactg
tacgtcgacgaggtcaacctgctggatgaccatctcgtcgatgtgctgctggattccgct
gcgtcggggtggaacacggtggagagggagggtatctccatatcccaccctgctcgcttc
atcctcatcggctctggtaacccggaggaaggggagctcaggccacagctgctggaccgg
ttcgggatgcacgcacaggttggtaccgtcagggatgccgagctcagggtgaagatcgtg
gaggagagagctcgtttcgacagggatccaaagacgttccgtgagtcgtacaatgaggag
caggagaagctccagcagcagatatcatctgcacggagtaaccttggcgctgtgcagatt
gaccatgacctccgtgtcaagatatccaaggtgtgctctgagctgaatgttgatggactc
agaggcgacattgtgactaacagggctgccaaggctctggctgcgttgaaaggaagggac
agcgtcactgtggaggatattgctactgtcattccaaactgcttgaggcatcggctccgg
aaggatccgcttgaatccattgactcgggtttgcttgtcattgagaagttttatgaagtc
tttagctag

  All links  
No link information was found.   
DBGET integrated database retrieval system