KEGG   Sorghum bicolor (sorghum): SORBI_08g004300Help
Entry
SORBI_08g004300   CDS       T01086                                 

Gene name
SORBIDRAFT_08g004300, Sb08g004300
Definition
hypothetical protein
Orthology
K03405  
magnesium chelatase subunit I [EC:6.6.1.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:sbi00860]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 422 aa AA seqDB search
MPLPPLLPAMASTFSPTSAARALLPASTSRPLFLAAASSGRIQPSRKGLDFRRGRFTVCN
VAAPTAAEQEATASSAAKESQRPVYPFAAIVGQDEMKLCLLLNVIDPKIGGVMIMGDRGT
GKSTTVRSLVDLLPDIRVVVGDPFNSDPDDPEVMGPEVRERVLRGDAGLPVTTAKITMVD
LPLGATEDRVCGTIDIEKALTEGVKAFEPGLLAKANRGILYVDEVNLLDDHLVDVLLDSA
ASGWNTVEREGISISHPARFILIGSGNPEEGELRPQLLDRFGMHAQVGTVRDAELRVKIV
EERARFDRDPKTFRESYNEEQEKLQQQISSARSNLGAVQIDHDLRVKISKVCSELNVDGL
RGDIVTNRAAKALAALKGRDSVTVEDIATVIPNCLRHRLRKDPLESIDSGLLVIEKFYEV
FS
NT seq 1269 nt NT seq  +upstreamnt  +downstreamnt
atgccccttcctcctctcctccccgccatggcttccaccttctcccccacttccgccgcg
agggccctcctcccggcctccacctcccgcccactcttcctcgccgcagcttcctcaggt
cgcattcaaccatccaggaaggggctggacttccgccgcggccggttcaccgtctgcaat
gtcgccgcccccaccgccgccgagcaggaggcgacggcgtcgtcggccgcgaaggagagc
cagcggcccgtgtacccgttcgcggccatcgtggggcaggacgagatgaagctctgcctg
ctgctcaacgtcatcgaccccaagatcggcggcgtgatgatcatgggcgacaggggcacg
ggcaagtccaccaccgtgcgctccctcgtcgacctgctcccggacatccgcgtcgtcgtc
ggcgaccccttcaactccgacccggacgacccagaggtgatggggcctgaggtccgcgag
cgggtgctgcgtggggacgccggcctccctgtcaccaccgccaagatcaccatggtcgac
ctgcccctcggcgccaccgaggaccgcgtctgtggcaccatcgacatcgagaaggcgctc
accgagggcgttaaggcgttcgagcccggcttgctcgccaaggccaacaggggcatactg
tacgtcgacgaggtcaacctgctggatgaccatctcgtcgatgtgctgctggattccgct
gcgtcggggtggaacacggtggagagggagggtatctccatatcccaccctgctcgcttc
atcctcatcggctctggtaacccggaggaaggggagctcaggccacagctgctggaccgg
ttcgggatgcacgcacaggttggtaccgtcagggatgccgagctcagggtgaagatcgtg
gaggagagagctcgtttcgacagggatccaaagacgttccgtgagtcgtacaatgaggag
caggagaagctccagcagcagatatcatctgcacggagtaaccttggcgctgtgcagatt
gaccatgacctccgtgtcaagatatccaaggtgtgctctgagctgaatgttgatggactc
agaggcgacattgtgactaacagggctgccaaggctctggctgcgttgaaaggaagggac
agcgtcactgtggaggatattgctactgtcattccaaactgcttgaggcatcggctccgg
aaggatccgcttgaatccattgactcgggtttgcttgtcattgagaagttttatgaagtc
tttagctag

DBGET integrated database retrieval system