KEGG   Sorghum bicolor (sorghum): SORBI_08g005050Help
Entry
SORBI_08g005050   CDS       T01086                                 

Gene name
SORBIDRAFT_08g005050, Sb08g005050
Definition
hypothetical protein
Orthology
K00627  
pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    SORBI_08g005050 (SORBIDRAFT_08g005050)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    SORBI_08g005050 (SORBIDRAFT_08g005050)
   00020 Citrate cycle (TCA cycle)
    SORBI_08g005050 (SORBIDRAFT_08g005050)
   00620 Pyruvate metabolism
    SORBI_08g005050 (SORBIDRAFT_08g005050)
Enzymes [BR:sbi01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     SORBI_08g005050 (SORBIDRAFT_08g005050)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 458 aa AA seqDB search
MAGLLNLQSTLLPSASALRRRAGAPGPSSSRRRCRVEAKIREIFMPALSSTMTEGKIVSW
TAAEGDRLAKGDPVVVVESDKADMDVETFHDGFLAAVLVPAGESAPVGSAIALLAESEEE
IPVAQSQAASFSSSSPSPPPPQETAAQEESLPPPPPPTPAPVAVSAPAPPSPAAQGGGRV
VASPYAKKLAKDLGVDLFSVTGSGPGGRIVAKDVESALAAPKKAVPATAARPDVPLGSTV
PFTTMQGAVSKNMVESLAVPTFRVGYTITTDALDQLYKKIKSKGVTMSALLAKATAMALV
QHPVVNSSCRDGKSFTYNSSINIAVAVAIDGGLITPVLQDADKLDIYSLSRKWKELVDKA
RAKQLQPHEYNSGTFTLSNLGMFGVDRFDAILPPGTGAIMAVGASEPTIVGTKDGRIGIK
NQMQVNVTADHRIIYGADLAAFLQTLAKIIEDPKDLTF
NT seq 1377 nt NT seq  +upstreamnt  +downstreamnt
atggccggcctcctcaacctccagtcgacgcttctcccctcggcgtccgcgctgcgccgc
cgcgcgggcgcgccggggccgtcctcgtcccgccgccgatgccgtgtcgaggccaagatc
cgggagatcttcatgccggcgctcagctccaccatgaccgagggcaagatcgtctcctgg
accgccgccgagggcgaccgactcgccaagggcgaccccgtcgtcgtcgtcgagtccgac
aaggccgacatggacgtcgagaccttccacgacggcttcctcgccgccgtcctcgtcccc
gccggcgagtccgcgcccgtcggctccgccatcgcgctcctcgccgagtccgaggaggag
atcccggtcgcccagtcgcaggccgcctccttctcctccagctccccctcgccgccgcct
ccgcaagaaactgctgctcaagaagagtcccttccgccgccgccacctcctaccccagcg
ccggtggcagtctctgctcccgcgccgccttcgccagcagcacaaggcggggggcgcgtt
gttgcttcgccctacgccaagaagctcgccaaggacctcggcgttgatcttttctcggtc
acggggtcaggccccggcgggcgaattgtggccaaggatgtcgagtctgcgcttgctgcg
cccaagaaggccgtaccagcgactgctgcacggccggatgtgccattgggatcgacggta
ccattcacgacaatgcagggtgctgtcagcaagaacatggtggagagccttgccgtcccg
acattcagggtcgggtacaccatcacgactgatgctcttgatcagctctacaaaaaaatt
aagtcaaagggggttacaatgtcagcactattggctaaggcgacggcaatggctctggtt
cagcatcctgtagtcaactccagctgcagggatgggaagagcttcacatacaacagtagt
atcaacattgctgtggcagtggccatagatggtgggttgattacaccggttcttcaagat
gctgataagcttgacatttattcattgtcaaggaaatggaaggagttggttgataaggca
cgagcaaagcagttgcagcctcatgagtacaactctggcacgtttactctttcgaatctt
ggtatgtttggagttgataggtttgatgcaatactgccacctggaactggagcaatcatg
gccgttggggcatcagaaccgaccattgttggtacaaaagatggtagaattgggatcaag
aaccaaatgcaggtaaatgttaccgctgatcatcggattatttatggagctgaccttgct
gcttttctgcaaacacttgccaagataattgaggatcccaaggatcttacattttaa

DBGET integrated database retrieval system