KEGG   Sorghum bicolor (sorghum): SORBI_08g005190Help
Entry
SORBI_08g005190   CDS       T01086                                 

Gene name
SORBIDRAFT_08g005190, Sb08g005190
Definition
hypothetical protein
Orthology
K15422  
3'(2'), 5'-bisphosphate nucleotidase / inositol polyphosphate 1-phosphatase [EC:3.1.3.7 3.1.3.57]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Inositol phosphate metabolism
Sulfur metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:sbi00562]
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sbi00920]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:sbi04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 354 aa AA seqDB search
MSQAPGVAGSPYAAELAAAKKAVALAARLCQRVQRGILQSDIQSKADKTPVTVADYGSQV
LVCLVLKKELPSHSFSIVAEEDSKDLREDGAQEILEHITTLVNETIVNDGSYNMSLSKED
VLAAIDGGKSEGGPSGRHWILDPIDGTKGFIRGDQYAVALGLLDEGKVVLGVLGCPNLPL
KSTNKNNSSFSGDQIGSLFFATIGCGAQVEALEGSEPQKISVCSINNPVDASFFESFEAS
HSKRDLTSSIAEKLGVQAPPVRMDSQAKYGALARGDGDIFLRIPHKSYIETVWDHAAGSI
VVTEAGGMVKDASGNDLDFSKGRYLDRDRGIIATNKHLMPLVLKAVQEAMKEEQ
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgtcgcaggctccgggggtcgccggaagcccgtacgccgccgagctcgccgcagccaag
aaggccgtcgcccttgcggcccgcctctgccagagagtgcagcggggcatcttgcaatct
gacattcaatcgaaggcagacaagactcctgttacagtcgcggattatggatcacaagta
ttggtatgtctggtcctgaagaaggaattgccttctcactctttctcaatcgtagctgaa
gaggattcaaaagacttgagagaagatggtgcccaagaaattctagaacacattactacc
cttgtaaatgaaaccattgtaaatgatggttcgtacaacatgtcgttatctaaggaagac
gtgcttgctgcaattgatggtggtaaatctgagggaggtccatctgggcgacattggata
ttggacccaatagatggcactaaaggtttcataaggggagatcagtatgcagttgcactt
ggactgcttgatgagggcaaagttgttctgggtgtgttgggatgtccaaatcttccatta
aaatcaacaaacaagaacaatagcagcttttctggggatcaaataggttccctctttttt
gccacaattggttgtggagcgcaagttgaggccttagaaggatctgagccacaaaagatt
agtgtttgctccatcaataatccagtcgacgcctcattctttgaatcctttgaagcatca
cactccaagcgtgatttaactagctccattgcagagaaacttggtgtccaagctcctcct
gttagaatggatagccaagcaaaatatggtgccctagcacgtggtgatggtgacattttt
ctgcgcattccgcacaaaagttacatagaaacagtttgggatcatgcagctggatcaatt
gttgtcacagaagctggtggcatggtaaaagatgcctcaggaaacgatttggatttttcc
aaaggtagatatcttgatcgtgacagaggaattattgcaacaaataaacatttaatgcca
cttgttctaaaggcggttcaagaggctatgaaggaggaacagtag

DBGET integrated database retrieval system