KEGG   Sorghum bicolor (sorghum): SORBI_08g009560Help
Entry
SORBI_08g009560   CDS       T01086                                 

Gene name
SORBIDRAFT_08g009560, Sb08g009560
Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SORBI_08g009560 (SORBIDRAFT_08g009560)
   03420 Nucleotide excision repair
    SORBI_08g009560 (SORBIDRAFT_08g009560)
   03430 Mismatch repair
    SORBI_08g009560 (SORBIDRAFT_08g009560)
   03440 Homologous recombination
    SORBI_08g009560 (SORBIDRAFT_08g009560)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 163 aa AA seqDB search
MPSQSTESSGLSKVRLVGRMLNEVQHVRDVQFTLHDGAGKIDVNRWENESSDAKEMADVN
DGDYVIVNGGLKGFQGKRHIVAYSVRRVTDFNEIPHHFLHCIQVHLDHTRPKAQINASTA
TLGHTNQVRPFNNQAATFSASGNAVGNSISDLVMSVFNDPEAM
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgccctcacagtccacggagagcagcggcctctccaaggttaggcttgttggacgcatg
ttgaatgaggttcagcacgtcagagatgttcaattcactcttcatgatggtgccggcaag
atagatgtgaatcgttgggaaaatgagtcttccgacgctaaggaaatggctgatgtcaat
gacggggactatgttatagtcaatggcggtttgaaaggttttcaaggaaagcgccatata
gttgcctactctgtgcgacgtgtgacagacttcaatgaaataccccatcactttctgcac
tgcattcaggtgcatctagatcacaccaggccaaaggcccaaataaatgccagtacggca
acccttggtcatactaaccaagttcggccctttaataatcaggctgcaacattttctgca
tcaggaaatgctgttggaaacagcatatctgacttggtcatgagtgtttttaatgatcca
gaagccatgtaa

DBGET integrated database retrieval system