KEGG   Sorghum bicolor (sorghum): SORBI_08g014950Help
Entry
SORBI_08g014950   CDS       T01086                                 

Gene name
SORBIDRAFT_08g014950, Sb08g014950
Definition
hypothetical protein
Orthology
K11858  
ubiquitin carboxyl-terminal hydrolase 48 [EC:3.1.2.15]
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     SORBI_08g014950 (SORBIDRAFT_08g014950)
Peptidases [BR:sbi01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   SORBI_08g014950 (SORBIDRAFT_08g014950)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 315 aa AA seqDB search
MQEIIRALGSNPSRDLRDSTDTPAGLTNLGATCYANSILQCLYMNISFRTGIFSLELEVL
KKHPVLDQLSRLFAQLHSSKMAFIDSAPFIKALELDNGVQQDSHEFLTLFLSLLEQSLSH
SKVPGARTIVQHLFCGRVSHVTRCSSCGKDSAASSKMEDFYELELNIKGLNTLEESLNDY
FSEEALDGENQYFCESCQKRVDATRCIKLRSLPPVVNFQLKRYVFLPKTTTKKKISSTFS
FPRQLDLGKRLSNPSSSCTYDLAAILVHKGTGANSGHYVAHIKDESNGQWWEFDDETVSK
LGVQPVWRKTWKGVK
NT seq 948 nt NT seq  +upstreamnt  +downstreamnt
atgcaggaaattatccgcgctcttggctctaatccatccagggacctccgtgattccact
gatacgcctgctggattgactaacctgggtgcaacctgttatgcaaatagcatacttcag
tgcctttacatgaatatatccttccgcacaggaattttctctttagagctggaagttttg
aagaagcatcctgtcctggatcagttgtcacggctgtttgcacagctacactctagcaaa
atggctttcattgattccgcaccttttattaaagcgctggaattagacaatggtgtccaa
caggacagccatgaatttctcaccttgttcctgtctctgcttgagcaatcgttaagtcat
tccaaggttcctggagctagaacaattgtgcaacatctgttttgcggccgtgtatcacac
gtgacaaggtgctcatcatgtggaaaggattctgcagcatcttcaaaaatggaagacttt
tacgagctggagttgaatattaaaggtttaaatactttagaagaaagtcttaatgactac
tttagtgaagaagcactggatggggagaaccaatacttttgtgagtcatgtcagaaaagg
gtagatgccactcgctgcataaaacttcgatcacttcctccggttgtcaactttcagcta
aagcgctatgtattcctcccgaagacaacaacaaagaaaaagatttcttcaacgttcagt
ttcccgagacagcttgatttgggaaaacggttgtcaaacccttcatctagttgtacttat
gacctggctgctattttagttcacaagggtactggtgctaatagtggacactatgttgca
cacataaaagatgaaagcaatgggcagtggtgggagtttgatgatgagactgtatccaaa
ctcggtgtgcaacccgtttggcgaaaaacctggaaaggcgtcaaataa

DBGET integrated database retrieval system