KEGG   Sorghum bicolor (sorghum): SORBI_08g016820Help
Entry
SORBI_08g016820   CDS       T01086                                 

Gene name
SORBIDRAFT_08g016820, Sb08g016820
Definition
hypothetical protein
Orthology
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Class
Metabolism; Overview; Fatty acid metabolism [PATH:sbi01212]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:sbi00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:sbi00640]
Metabolism; Lipid metabolism; Fatty acid biosynthesis [PATH:sbi00061]
Metabolism; Biosynthesis of other secondary metabolites; Aflatoxin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 2248 aa AA seqDB search
MAEPYQMNGILNGMPNLRHPSSPSEVDEFCKALGGDSPIHSVLVANNGMAAVKFMRSIRI
WALETFGTEKAILLVAMATPEDLRINAEHIRIADQFVEVPGGTNNNNYANVRLIVEIAER
TRVSAVWPGWGHASENPELPDALNEKGIIFLGPPSAAMAALGDKIGSSLIAQAAGVPTLP
WSGSHVKVPPESCHSIPEEIYKNACVSTTEEAVASCQVVGYPAMIKASWGGGGKGIRKVH
NDDEVRALFKQVQGEVPGSPIFIMKVASQSRHLEVQLLCDKHGNVAALHSRDCSVQRRHQ
KIIEEGPITVAAPDTVKELEQAARRLAKCVQYVGAATVEYLYSMETGEYYFLELNPRLQV
EHPVTEWIAEVNLPAAQVAVGMGIPLYNIPEIRRFYGMDHGGGYHDWRKISAVATKFDLD
KAQSVRPKGHCVAVRVTSEDPDDGFKPTSGRVESGGAIHEFSDSQFGHVFAFGESRSLAI
ANMVLGLKEIQIRGEIRTNVDYTVDLLNAAEYRENKIHTGWLDSRIAMRVRAERPPWYLS
VVGGALYEASSRSSSVVTDYVGYLSKGQIPPKHISLVNLSVTLNIEGSKYTIETVRGGPR
SYKLRMNGSEIEAEIHSLRDGGLLMQLDGNSHVIYAETEAAGTRLLINGRTCLLQKEHDP
SKLLADTPCKLLRFLVADGSHVDADTPYAEVEVMKMCMPLLLPASGVIHFVMPEGQAMQA
SDLIARLDLDDPSSVRRAEPFHGSFPKLGPPTAISGKVHQKFAASVNSAHMILAGYEHNI
NDVVQDLLNCLDSPELPFLQWQELMSVLATRLPKDLRNELDGKYKEYELNPDFCKSKDFP
AKLLRGVIEANLAYCSEKDRVTNERLVEPLMSLVKSYEGGRESHARVVVKSLFEEYLSVE
ELFNDNLQSDVIERLRLQHAKDLEKVVYIVFSHQGVRSKNKLILRLMEALVYPNPSAYRD
QLIRFSALNHTSYSELALKASQLLEHTKLSELRTSIARSLSELEMFTEEGERLSTPRRKI
AINERMEDLVCAPLAVEDALVALFDHSDPTLQRRVVETYIRRLYQPYLVSGSIRMQWHRA
GLIAIWEFSEEHLKQRIGQDVPLQQVENSTEKRWGVMVVIKSLQFLATAIDVALKETSQY
RVGVGSVSNGDHVNSNQSNMLHIALVGINNQMSTLQDSGDEDQAQERVNKLSKILKDNTI
TSHLNGASVKVVSCIIQRDEGRPPMRHSFQWSVDKLYYEEDPMLRHVEPPLSTFLELEKV
NLEGYNEVKYTPSRDRQWHIYTLIKNKKDQRLNDQRMFLRTIVRQPSATNGFLSGNIDNE
VGRTQASSSFTSNSILRSLMGALEEIELHAHSETVRSGHSQMYLCLLREQQLHELIPFSR
MTDEIDQDEGTACTLLKHMVLNLYEHVGVRMHRLSVCQWEVKLWLVCDGQASGAWRVVVT
NVTGHTCTIDIYREVEDPSTHQLLYHSATATAGPLHGVALNEPYKPLDAIDLKRYAARKN
ETTYCYDFPLAFETALKRLWKSSSYGVSEANERNQLYAEVKELIFVDSDGAWGTPLVSFE
RPPGINDIGIVAWNMKLSTPEFPSGREIIVVANDVTFKAGSFGPREDAFFDAVTNLACER
KLPLIYLAATAGARLGVAEEIKSCFHVGWSDDESPERGFQYIYLTTQDYSRLSSSVIAHE
LQLENGETRWVVDTIVGKEDGLGCENLHGSGAIASAYSKAYKETFTLTFVTGRAVGIGAY
LARLGMRCIQRLDQPIILTGFSALNKLLGREVYSSHMQLGGPKIMATNGVVHQTVSDDLE
GVSAILKWLSYVPPYVGGPLPIMKPLDPPERPVAYFPENACDARAAICGIQDGEGKWLGG
MFDRETFVETLEGWAKTVITGRAKLGGIPVGVIAVETQTVMQVIPADPGQLDSAERVVPQ
AGQVWFPDSAAKTAQALMDFNREELPLFILANWRGFSGGQRDLFEGILQAGSTIVENLRT
YKQPAFVYIPMGGELRGGAWVVVDSKINPDHIEMYAERTAKGNVLEAEGLVEIKFRPKEL
EDCMLRLDPELIGLNARLKDMKKQNASISEMETIRRSMTIRMKQLMPIYTQVATRFAELH
DTSARMAAKGVIGKVVDWEESRAFFYRRLRRRVAEDALAKEVKEAAGEQLSHRSALDSIK
KWYLVSKGTEGGSEMWNDDESFFAWKDDSKNYENYLEELKAERVSNWFSHLAESSDVKAL
PNGLSLLLNKMNPLKREQVIDGLRQLLG
NT seq 6747 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccctaccaaatgaacggcatactgaacgggatgcctaatttgaggcatcca
tcctctccatcagaagtcgatgaattctgtaaagcgcttggtggtgactcgccaatacac
agtgtgctagtcgctaacaatgggatggccgcggtcaagttcatgcgcagcatccggata
tgggccctggagacctttgggacagagaaggccattcttttggttgctatggcaacaccg
gaggacttgaggataaacgctgagcacataagaattgctgatcagttcgtagaagttcct
ggaggaacaaacaataacaactatgcgaatgtacggcttatagttgagattgcagagaga
actcgtgtatctgcagtttggcctggctggggtcatgcgtctgagaacccagaacttcca
gatgctctaaacgagaaaggaatcatttttcttgggccaccatcagctgcaatggctgca
cttggtgataagattggttcttctctcattgcacaagcagcaggagttccaactcttcca
tggagtggatcacatgtaaaagttccaccagaaagctgccattcaattcccgaggagata
tataagaatgcttgtgtttccaccacagaggaagcagtggctagttgtcaggtggttggg
taccctgccatgatcaaggcatcttggggaggcggtggtaaaggaataagaaaggttcat
aacgatgatgaggtgagggcactgttcaagcaagttcaaggagaagtccctggctcgcct
atatttattatgaaagtggcatctcagagccgacatctggaggttcaattgctctgtgat
aaacatggcaatgtggcagcactacacagtcgagattgcagtgttcaaagaaggcaccaa
aagattattgaagaggggccaatcacagttgctgctccagacactgttaaagagcttgag
caggcagcaaggcggcttgctaagtgtgttcaatacgttggtgctgctaccgtagaatat
ctgtacagcatggaaacgggtgaatactattttttggagcttaatccacggttgcaggta
gaacatcctgtgactgaatggatagctgaagtaaacttgccagcagcccaagttgcagtc
ggaatgggcatacccctctataacattccagagattagacgcttttatggaatggaccat
gggggaggctaccatgattggaggaaaatatcagctgttgcaactaagtttgatttggat
aaagcacagtcagtgaggccgaagggccattgtgttgcagtcagagttactagtgaggat
cctgatgatgggtttaagcctacaagtggaagagtggagtctggaggagcaattcatgaa
ttctctgattcacagtttggtcatgtttttgcatttggggaatctagatctttagccata
gccaatatggtacttgggctaaaagagattcagatccgtggagagatacgcacaaatgtt
gattacacagtggatctcttgaatgccgcagagtaccgcgaaaataagatccatactggt
tggcttgacagcagaatagctatgcgtgttagagcagagaggcccccatggtacctctca
gttgttggaggagctctatatgaagcatcaagcaggagctcaagcgttgttactgattat
gttggttatctcagcaaaggtcagataccaccaaagcacatctcgcttgtcaatttaagt
gttactctgaacatagaggggagcaaatacacgattgagacagttaggggtggaccccgc
agctacaaattaagaatgaatggatcagaaattgaagcagagatacattcactgcgagat
ggtggacttttaatgcagttggatggaaacagtcatgtaatttatgcagagacggaggct
gctggtacacgccttctcattaatggtagaacatgcttactacagaaagaacatgatcct
tcaaagttgttggctgatacaccttgcaaacttcttcggttcttggttgccgatggctct
catgtggatgctgatacaccatatgctgaggtggaagtcatgaagatgtgcatgccactg
ttactgcctgcctctggtgtcattcactttgttatgcctgagggtcaggccatgcaggcg
agtgacctgatagcaagattggaccttgatgacccctcttctgtgaggagagctgaacca
tttcatggttcctttcccaaactgggacctcctaccgctatctctggcaaagttcatcaa
aaatttgctgcaagtgtgaattctgcacacatgatccttgcaggatatgaacataatatc
aatgacgttgtacaagatttgctaaactgcctagacagccctgagctcccttttctacaa
tggcaagaacttatgtctgttttagcaacacggcttccaaaagatcttaggaatgagttg
gatggtaagtacaaggagtatgaattgaatcctgacttctgcaagagtaaggatttccct
gcaaagttgctgaggggggttattgaggcaaatcttgcatactgttcggagaaagatagg
gttactaatgagaggcttgtggaaccacttatgagcctggtcaagtcatatgagggtgga
agagaaagccatgctcgtgttgttgtcaaatctctatttgaggagtatctgtctgttgaa
gagctcttcaatgataaccttcagtctgatgttatagagcgtctacgccttcaacatgca
aaagaccttgagaaggttgtatacattgtgttctcacaccagggtgtgaggagcaaaaac
aaattaatactacggcttatggaggcattggtatatccaaacccatctgcttacagggat
cagctgattcgcttctctgctttgaaccatacatcatattccgagctggcacttaaagca
agccaacttcttgagcacactaaattgagtgaacttcgcacaagcatagcaagaagcctt
tcagagctggaaatgtttactgaggaaggagagcgtttgtcaacacctaggagaaagata
gcgataaatgagagaatggaagatttagtttgtgctccactggcagttgaagatgctctt
gtagcgttgttcgatcacagtgatcctactcttcaacggagagtggttgagacatatata
cgcagattgtatcagccttatcttgtaagtggaagtatccggatgcaatggcaccgagct
ggcctaattgccatatgggagttctctgaagagcatcttaagcaaagaattgggcaagat
gtgcccctacagcaagtagagaattccactgagaagagatggggcgtcatggttgtaatt
aagtctctccagtttttagcaactgcaattgatgttgcactgaaggagacttcacagtac
agagtgggtgtcggaagtgtctcgaacggtgaccatgtaaattctaatcaaagcaatatg
cttcatattgctttggttggtatcaataatcagatgagtactctccaagacagtggtgat
gaggatcaagcacaagaaagggtcaacaaactatccaagattttgaaggataacactatt
acatcacatcttaatggcgctagtgttaaggttgtcagctgtattatccaaagagatgaa
gggcgtccaccaatgcgacactccttccaatggtctgttgacaagctttattatgaggag
gatccaatgcttcgccatgtggaaccgccgttgtctacattccttgagctggagaaagta
aatttggaaggttacaatgaagtaaaatacaccccatcacgtgatcgtcagtggcatatt
tatacacttatcaagaacaagaaagatcagagattaaacgaccagagaatgttccttcgt
accatagtcagacaaccaagtgcaacaaatggtttcctgtcaggtaatattgacaatgaa
gtaggccgcacacaagcttcatcgtcgttcacatcaaacagcattctcagatcattgatg
ggagcactagaagaaatagagctacatgctcatagtgagactgtgagatcaggccactca
cagatgtatctgtgcttactgagagaacaacaattgcatgaactaattccattttcaagg
atgactgatgaaattgatcaggatgaaggaactgcatgtacacttttgaagcatatggta
ttgaatttatatgaacatgttggggtcaggatgcatcgtctttctgtgtgccagtgggaa
gtcaagctctggttggtttgtgatgggcaagctagtggtgcttggagagttgttgttacc
aatgttactggtcacacctgcaccattgatatttaccgagaagtggaagaccccagcaca
catcagcttctctaccactctgccacagccacggctggtcctttgcatggtgttgcattg
aatgaaccatacaagcctttggacgctattgacctcaaacgttatgctgctaggaaaaat
gaaaccacatactgctacgatttccccttggcatttgaaacagcgctgaagagattatgg
aaatcaagtagctatggtgttagtgaagctaatgagcgcaatcaactctatgctgaagtg
aaagagcttatatttgttgattcggatggagcatggggcactccattggtttcatttgaa
cgccctccaggcatcaatgatattggcattgttgcttggaacatgaagctgtccacgcca
gaattcccaagtggccgggagattatagttgttgccaatgatgtgacatttaaagctggg
tcctttggtccaagagaagatgcattttttgatgctgttaccaatcttgcctgtgagagg
aaacttcctcttatctatctggcagcaactgctggtgccaggcttggtgtagctgaggaa
ataaagtcatgcttccatgtcggctggtctgatgatgagagccctgaacgtggttttcag
tacatttacctcactacacaagattactcacgtctaagctcttcagtaatagctcacgag
ctgcaactagaaaatggagaaaccagatgggtggttgataccattgttggtaaagaggat
ggacttggttgtgagaatctccatggaagtggtgcgattgccagtgcatattccaaggca
tacaaagagacctttactctgacatttgtgactggaagagctgttggcattggggcttat
ctggctcgtttaggtatgaggtgtatacaacgtcttgatcaaccaattattctgactggg
ttttctgcactaaacaagcttctggggcgggaggtgtacagttctcatatgcaattgggt
ggccccaaaatcatggctacaaatggtgttgtccaccaaactgtgtcagatgaccttgaa
ggtgtttctgctatcctgaaatggctcagttatgttcctccatatgttggtggtcctctt
cccattatgaaacccctggacccacccgaaagaccagtagcatacttccctgagaatgct
tgtgatgctcgtgcagccatctgtggcattcaagacggtgaagggaagtggttaggtggt
atgtttgatagggaaaccttcgtggaaacattggaaggttgggcaaaaacagttatcacc
ggaagagcaaagcttggtggaataccagttggtgtcatagctgtggaaacccagactgtg
atgcaagtcatcccagctgatccaggtcagcttgattccgctgagcgtgtagtccctcaa
gcaggtcaggtgtggttcccagattctgcagccaaaacagctcaggcattaatggatttc
aaccgtgaggagcttccactgttcatccttgcaaactggagaggtttctctggtgggcaa
agggatttatttgaaggaatccttcaggctggttcaacaattgttgagaatctgaggacg
tacaagcagcctgcttttgtatatatcccaatgggtggagagctacggggaggggcctgg
gttgtggtggacagcaagatcaatccggaccacatagagatgtatgctgagaggactgcg
aaagggaatgtccttgaggcagaaggattggtggagataaaattcaggccaaaggaactg
gaagattgcatgctaaggcttgacccagaattgattggcctgaatgctaggctgaaagac
atgaagaaacaaaatgccagcatctcggaaatggagaccatacggaggagtatgactatt
cggatgaagcagttgatgcctatttatactcaggttgccacacgatttgccgaattgcat
gacacctctgctagaatggctgccaaaggtgtgatcggtaaggttgttgattgggaagag
tctcgggccttcttctacaggagattgcgaaggagagttgctgaggatgccctggccaag
gaagttaaagaagctgctggtgagcagctttcccacagatcagcactagactctatcaag
aaatggtatctagtgtccaaaggaactgaaggtggtagtgaaatgtggaatgatgatgaa
tctttctttgcttggaaggatgattccaagaactatgaaaattatctcgaggagttgaag
gctgaaagagtatcgaactggttctcgcatcttgctgaaagttccgacgtgaaagctctg
ccaaacggtctttcactcctccttaacaagatgaatcctctgaagagggagcaggtcatt
gatggcctcaggcagcttcttggttga

DBGET integrated database retrieval system