KEGG   Sorghum bicolor (sorghum): SORBI_08g016820Help
Entry
SORBI_08g016820   CDS       T01086                                 

Gene name
SORBIDRAFT_08g016820, Sb08g016820
Definition
(RefSeq) hypothetical protein
  KO
K11262  
acetyl-CoA carboxylase / biotin carboxylase [EC:6.4.1.2 6.3.4.14]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Fatty acid biosynthesis
Pyruvate metabolism
Propanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Fatty acid metabolism
Module
Fatty acid biosynthesis, initiation
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SORBI_08g016820 (SORBIDRAFT_08g016820)
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    SORBI_08g016820 (SORBIDRAFT_08g016820)
   00640 Propanoate metabolism
    SORBI_08g016820 (SORBIDRAFT_08g016820)
  Lipid metabolism
   00061 Fatty acid biosynthesis
    SORBI_08g016820 (SORBIDRAFT_08g016820)
  Biosynthesis of other secondary metabolites
   00254 Aflatoxin biosynthesis
    SORBI_08g016820 (SORBIDRAFT_08g016820)
Enzymes [BR:sbi01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.14  biotin carboxylase
     SORBI_08g016820 (SORBIDRAFT_08g016820)
  6.4  Forming carbon-carbon bonds
   6.4.1  Ligases that form carbon-carbon bonds (only sub-subclass identified to date)
    6.4.1.2  acetyl-CoA carboxylase
     SORBI_08g016820 (SORBIDRAFT_08g016820)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 2248 aa AA seqDB search
MAEPYQMNGILNGMPNLRHPSSPSEVDEFCKALGGDSPIHSVLVANNGMAAVKFMRSIRI
WALETFGTEKAILLVAMATPEDLRINAEHIRIADQFVEVPGGTNNNNYANVRLIVEIAER
TRVSAVWPGWGHASENPELPDALNEKGIIFLGPPSAAMAALGDKIGSSLIAQAAGVPTLP
WSGSHVKVPPESCHSIPEEIYKNACVSTTEEAVASCQVVGYPAMIKASWGGGGKGIRKVH
NDDEVRALFKQVQGEVPGSPIFIMKVASQSRHLEVQLLCDKHGNVAALHSRDCSVQRRHQ
KIIEEGPITVAAPDTVKELEQAARRLAKCVQYVGAATVEYLYSMETGEYYFLELNPRLQV
EHPVTEWIAEVNLPAAQVAVGMGIPLYNIPEIRRFYGMDHGGGYHDWRKISAVATKFDLD
KAQSVRPKGHCVAVRVTSEDPDDGFKPTSGRVESGGAIHEFSDSQFGHVFAFGESRSLAI
ANMVLGLKEIQIRGEIRTNVDYTVDLLNAAEYRENKIHTGWLDSRIAMRVRAERPPWYLS
VVGGALYEASSRSSSVVTDYVGYLSKGQIPPKHISLVNLSVTLNIEGSKYTIETVRGGPR
SYKLRMNGSEIEAEIHSLRDGGLLMQLDGNSHVIYAETEAAGTRLLINGRTCLLQKEHDP
SKLLADTPCKLLRFLVADGSHVDADTPYAEVEVMKMCMPLLLPASGVIHFVMPEGQAMQA
SDLIARLDLDDPSSVRRAEPFHGSFPKLGPPTAISGKVHQKFAASVNSAHMILAGYEHNI
NDVVQDLLNCLDSPELPFLQWQELMSVLATRLPKDLRNELDGKYKEYELNPDFCKSKDFP
AKLLRGVIEANLAYCSEKDRVTNERLVEPLMSLVKSYEGGRESHARVVVKSLFEEYLSVE
ELFNDNLQSDVIERLRLQHAKDLEKVVYIVFSHQGVRSKNKLILRLMEALVYPNPSAYRD
QLIRFSALNHTSYSELALKASQLLEHTKLSELRTSIARSLSELEMFTEEGERLSTPRRKI
AINERMEDLVCAPLAVEDALVALFDHSDPTLQRRVVETYIRRLYQPYLVSGSIRMQWHRA
GLIAIWEFSEEHLKQRIGQDVPLQQVENSTEKRWGVMVVIKSLQFLATAIDVALKETSQY
RVGVGSVSNGDHVNSNQSNMLHIALVGINNQMSTLQDSGDEDQAQERVNKLSKILKDNTI
TSHLNGASVKVVSCIIQRDEGRPPMRHSFQWSVDKLYYEEDPMLRHVEPPLSTFLELEKV
NLEGYNEVKYTPSRDRQWHIYTLIKNKKDQRLNDQRMFLRTIVRQPSATNGFLSGNIDNE
VGRTQASSSFTSNSILRSLMGALEEIELHAHSETVRSGHSQMYLCLLREQQLHELIPFSR
MTDEIDQDEGTACTLLKHMVLNLYEHVGVRMHRLSVCQWEVKLWLVCDGQASGAWRVVVT
NVTGHTCTIDIYREVEDPSTHQLLYHSATATAGPLHGVALNEPYKPLDAIDLKRYAARKN
ETTYCYDFPLAFETALKRLWKSSSYGVSEANERNQLYAEVKELIFVDSDGAWGTPLVSFE
RPPGINDIGIVAWNMKLSTPEFPSGREIIVVANDVTFKAGSFGPREDAFFDAVTNLACER
KLPLIYLAATAGARLGVAEEIKSCFHVGWSDDESPERGFQYIYLTTQDYSRLSSSVIAHE
LQLENGETRWVVDTIVGKEDGLGCENLHGSGAIASAYSKAYKETFTLTFVTGRAVGIGAY
LARLGMRCIQRLDQPIILTGFSALNKLLGREVYSSHMQLGGPKIMATNGVVHQTVSDDLE
GVSAILKWLSYVPPYVGGPLPIMKPLDPPERPVAYFPENACDARAAICGIQDGEGKWLGG
MFDRETFVETLEGWAKTVITGRAKLGGIPVGVIAVETQTVMQVIPADPGQLDSAERVVPQ
AGQVWFPDSAAKTAQALMDFNREELPLFILANWRGFSGGQRDLFEGILQAGSTIVENLRT
YKQPAFVYIPMGGELRGGAWVVVDSKINPDHIEMYAERTAKGNVLEAEGLVEIKFRPKEL
EDCMLRLDPELIGLNARLKDMKKQNASISEMETIRRSMTIRMKQLMPIYTQVATRFAELH
DTSARMAAKGVIGKVVDWEESRAFFYRRLRRRVAEDALAKEVKEAAGEQLSHRSALDSIK
KWYLVSKGTEGGSEMWNDDESFFAWKDDSKNYENYLEELKAERVSNWFSHLAESSDVKAL
PNGLSLLLNKMNPLKREQVIDGLRQLLG
NT seq 6747 nt NT seq  +upstreamnt  +downstreamnt
atggcggagccctaccaaatgaacggcatactgaacgggatgcctaatttgaggcatcca
tcctctccatcagaagtcgatgaattctgtaaagcgcttggtggtgactcgccaatacac
agtgtgctagtcgctaacaatgggatggccgcggtcaagttcatgcgcagcatccggata
tgggccctggagacctttgggacagagaaggccattcttttggttgctatggcaacaccg
gaggacttgaggataaacgctgagcacataagaattgctgatcagttcgtagaagttcct
ggaggaacaaacaataacaactatgcgaatgtacggcttatagttgagattgcagagaga
actcgtgtatctgcagtttggcctggctggggtcatgcgtctgagaacccagaacttcca
gatgctctaaacgagaaaggaatcatttttcttgggccaccatcagctgcaatggctgca
cttggtgataagattggttcttctctcattgcacaagcagcaggagttccaactcttcca
tggagtggatcacatgtaaaagttccaccagaaagctgccattcaattcccgaggagata
tataagaatgcttgtgtttccaccacagaggaagcagtggctagttgtcaggtggttggg
taccctgccatgatcaaggcatcttggggaggcggtggtaaaggaataagaaaggttcat
aacgatgatgaggtgagggcactgttcaagcaagttcaaggagaagtccctggctcgcct
atatttattatgaaagtggcatctcagagccgacatctggaggttcaattgctctgtgat
aaacatggcaatgtggcagcactacacagtcgagattgcagtgttcaaagaaggcaccaa
aagattattgaagaggggccaatcacagttgctgctccagacactgttaaagagcttgag
caggcagcaaggcggcttgctaagtgtgttcaatacgttggtgctgctaccgtagaatat
ctgtacagcatggaaacgggtgaatactattttttggagcttaatccacggttgcaggta
gaacatcctgtgactgaatggatagctgaagtaaacttgccagcagcccaagttgcagtc
ggaatgggcatacccctctataacattccagagattagacgcttttatggaatggaccat
gggggaggctaccatgattggaggaaaatatcagctgttgcaactaagtttgatttggat
aaagcacagtcagtgaggccgaagggccattgtgttgcagtcagagttactagtgaggat
cctgatgatgggtttaagcctacaagtggaagagtggagtctggaggagcaattcatgaa
ttctctgattcacagtttggtcatgtttttgcatttggggaatctagatctttagccata
gccaatatggtacttgggctaaaagagattcagatccgtggagagatacgcacaaatgtt
gattacacagtggatctcttgaatgccgcagagtaccgcgaaaataagatccatactggt
tggcttgacagcagaatagctatgcgtgttagagcagagaggcccccatggtacctctca
gttgttggaggagctctatatgaagcatcaagcaggagctcaagcgttgttactgattat
gttggttatctcagcaaaggtcagataccaccaaagcacatctcgcttgtcaatttaagt
gttactctgaacatagaggggagcaaatacacgattgagacagttaggggtggaccccgc
agctacaaattaagaatgaatggatcagaaattgaagcagagatacattcactgcgagat
ggtggacttttaatgcagttggatggaaacagtcatgtaatttatgcagagacggaggct
gctggtacacgccttctcattaatggtagaacatgcttactacagaaagaacatgatcct
tcaaagttgttggctgatacaccttgcaaacttcttcggttcttggttgccgatggctct
catgtggatgctgatacaccatatgctgaggtggaagtcatgaagatgtgcatgccactg
ttactgcctgcctctggtgtcattcactttgttatgcctgagggtcaggccatgcaggcg
agtgacctgatagcaagattggaccttgatgacccctcttctgtgaggagagctgaacca
tttcatggttcctttcccaaactgggacctcctaccgctatctctggcaaagttcatcaa
aaatttgctgcaagtgtgaattctgcacacatgatccttgcaggatatgaacataatatc
aatgacgttgtacaagatttgctaaactgcctagacagccctgagctcccttttctacaa
tggcaagaacttatgtctgttttagcaacacggcttccaaaagatcttaggaatgagttg
gatggtaagtacaaggagtatgaattgaatcctgacttctgcaagagtaaggatttccct
gcaaagttgctgaggggggttattgaggcaaatcttgcatactgttcggagaaagatagg
gttactaatgagaggcttgtggaaccacttatgagcctggtcaagtcatatgagggtgga
agagaaagccatgctcgtgttgttgtcaaatctctatttgaggagtatctgtctgttgaa
gagctcttcaatgataaccttcagtctgatgttatagagcgtctacgccttcaacatgca
aaagaccttgagaaggttgtatacattgtgttctcacaccagggtgtgaggagcaaaaac
aaattaatactacggcttatggaggcattggtatatccaaacccatctgcttacagggat
cagctgattcgcttctctgctttgaaccatacatcatattccgagctggcacttaaagca
agccaacttcttgagcacactaaattgagtgaacttcgcacaagcatagcaagaagcctt
tcagagctggaaatgtttactgaggaaggagagcgtttgtcaacacctaggagaaagata
gcgataaatgagagaatggaagatttagtttgtgctccactggcagttgaagatgctctt
gtagcgttgttcgatcacagtgatcctactcttcaacggagagtggttgagacatatata
cgcagattgtatcagccttatcttgtaagtggaagtatccggatgcaatggcaccgagct
ggcctaattgccatatgggagttctctgaagagcatcttaagcaaagaattgggcaagat
gtgcccctacagcaagtagagaattccactgagaagagatggggcgtcatggttgtaatt
aagtctctccagtttttagcaactgcaattgatgttgcactgaaggagacttcacagtac
agagtgggtgtcggaagtgtctcgaacggtgaccatgtaaattctaatcaaagcaatatg
cttcatattgctttggttggtatcaataatcagatgagtactctccaagacagtggtgat
gaggatcaagcacaagaaagggtcaacaaactatccaagattttgaaggataacactatt
acatcacatcttaatggcgctagtgttaaggttgtcagctgtattatccaaagagatgaa
gggcgtccaccaatgcgacactccttccaatggtctgttgacaagctttattatgaggag
gatccaatgcttcgccatgtggaaccgccgttgtctacattccttgagctggagaaagta
aatttggaaggttacaatgaagtaaaatacaccccatcacgtgatcgtcagtggcatatt
tatacacttatcaagaacaagaaagatcagagattaaacgaccagagaatgttccttcgt
accatagtcagacaaccaagtgcaacaaatggtttcctgtcaggtaatattgacaatgaa
gtaggccgcacacaagcttcatcgtcgttcacatcaaacagcattctcagatcattgatg
ggagcactagaagaaatagagctacatgctcatagtgagactgtgagatcaggccactca
cagatgtatctgtgcttactgagagaacaacaattgcatgaactaattccattttcaagg
atgactgatgaaattgatcaggatgaaggaactgcatgtacacttttgaagcatatggta
ttgaatttatatgaacatgttggggtcaggatgcatcgtctttctgtgtgccagtgggaa
gtcaagctctggttggtttgtgatgggcaagctagtggtgcttggagagttgttgttacc
aatgttactggtcacacctgcaccattgatatttaccgagaagtggaagaccccagcaca
catcagcttctctaccactctgccacagccacggctggtcctttgcatggtgttgcattg
aatgaaccatacaagcctttggacgctattgacctcaaacgttatgctgctaggaaaaat
gaaaccacatactgctacgatttccccttggcatttgaaacagcgctgaagagattatgg
aaatcaagtagctatggtgttagtgaagctaatgagcgcaatcaactctatgctgaagtg
aaagagcttatatttgttgattcggatggagcatggggcactccattggtttcatttgaa
cgccctccaggcatcaatgatattggcattgttgcttggaacatgaagctgtccacgcca
gaattcccaagtggccgggagattatagttgttgccaatgatgtgacatttaaagctggg
tcctttggtccaagagaagatgcattttttgatgctgttaccaatcttgcctgtgagagg
aaacttcctcttatctatctggcagcaactgctggtgccaggcttggtgtagctgaggaa
ataaagtcatgcttccatgtcggctggtctgatgatgagagccctgaacgtggttttcag
tacatttacctcactacacaagattactcacgtctaagctcttcagtaatagctcacgag
ctgcaactagaaaatggagaaaccagatgggtggttgataccattgttggtaaagaggat
ggacttggttgtgagaatctccatggaagtggtgcgattgccagtgcatattccaaggca
tacaaagagacctttactctgacatttgtgactggaagagctgttggcattggggcttat
ctggctcgtttaggtatgaggtgtatacaacgtcttgatcaaccaattattctgactggg
ttttctgcactaaacaagcttctggggcgggaggtgtacagttctcatatgcaattgggt
ggccccaaaatcatggctacaaatggtgttgtccaccaaactgtgtcagatgaccttgaa
ggtgtttctgctatcctgaaatggctcagttatgttcctccatatgttggtggtcctctt
cccattatgaaacccctggacccacccgaaagaccagtagcatacttccctgagaatgct
tgtgatgctcgtgcagccatctgtggcattcaagacggtgaagggaagtggttaggtggt
atgtttgatagggaaaccttcgtggaaacattggaaggttgggcaaaaacagttatcacc
ggaagagcaaagcttggtggaataccagttggtgtcatagctgtggaaacccagactgtg
atgcaagtcatcccagctgatccaggtcagcttgattccgctgagcgtgtagtccctcaa
gcaggtcaggtgtggttcccagattctgcagccaaaacagctcaggcattaatggatttc
aaccgtgaggagcttccactgttcatccttgcaaactggagaggtttctctggtgggcaa
agggatttatttgaaggaatccttcaggctggttcaacaattgttgagaatctgaggacg
tacaagcagcctgcttttgtatatatcccaatgggtggagagctacggggaggggcctgg
gttgtggtggacagcaagatcaatccggaccacatagagatgtatgctgagaggactgcg
aaagggaatgtccttgaggcagaaggattggtggagataaaattcaggccaaaggaactg
gaagattgcatgctaaggcttgacccagaattgattggcctgaatgctaggctgaaagac
atgaagaaacaaaatgccagcatctcggaaatggagaccatacggaggagtatgactatt
cggatgaagcagttgatgcctatttatactcaggttgccacacgatttgccgaattgcat
gacacctctgctagaatggctgccaaaggtgtgatcggtaaggttgttgattgggaagag
tctcgggccttcttctacaggagattgcgaaggagagttgctgaggatgccctggccaag
gaagttaaagaagctgctggtgagcagctttcccacagatcagcactagactctatcaag
aaatggtatctagtgtccaaaggaactgaaggtggtagtgaaatgtggaatgatgatgaa
tctttctttgcttggaaggatgattccaagaactatgaaaattatctcgaggagttgaag
gctgaaagagtatcgaactggttctcgcatcttgctgaaagttccgacgtgaaagctctg
ccaaacggtctttcactcctccttaacaagatgaatcctctgaagagggagcaggtcatt
gatggcctcaggcagcttcttggttga

DBGET integrated database retrieval system