KEGG   Sorghum bicolor (sorghum): SORBI_08g019950Help
Entry
SORBI_08g019950   CDS       T01086                                 

Gene name
SORBIDRAFT_08g019950, Sb08g019950
Definition
hypothetical protein
Orthology
K04498  
E1A/CREB-binding protein [EC:2.3.1.48]
Organism
sbi  Sorghum bicolor (sorghum)
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
8
AA seq 1242 aa AA seqDB search
MMTQTLQGKVMAYTPSSFPVQQQILPEDIEMLQLDNMNQNTSPIRAIIIEKIEACLRNME
EFCDLCPDSCLKASRIIDNMLYKNAPQLHFYLDLETVEGRVNDLLRSFPYRKQRDPCISS
AVPSTKDLRQLPGIQMTDSSVYHNRVAPAFTNLPAHSGDVPPHTVFTSQRYVPQNHNMAA
ANLALVERPESFMSTVVAPSVSGLPNCISGLGGIDSAGLQNGYLKDHFPAVCDPTTSSGA
MIRSSVDSVSKASGQKLFTREEQLFQQYREYEKELDGAWSHPAEKAVHSNRTTQSNEIYF
KEECRPDTFMEMKENYWHTSDSRDSCREIYSNLSTPNAQYQCFMSDCDPRDPEREIVERS
EQTSNSTVSKPTSPISDESSGKRPAKRLKADAPTLVNVNQVESSKDQKPVTNENHVSGGE
TVQSEITELPAKSPCSSLGDINTDSNNMLEQGSEDAPNTELVKEEELYCAKGDIEMNEAN
TVAFDQTPRGVSLSTRRKRGASILYALTAEELRDHMSSLINQHTCLGKVISQEFPSIDGL
PDQNTCSLCGMERLLFEPPPRFCGLCFKIINSAGCYYVEVENGIEKTSICSKCHHLSSSR
AKYQKKFNYAETDAEAEWWVQCDKCKAWQHEICALFNRKCEGAKAEYTCAKCFLNEKDSG
DIQALESSTVLGAQELPRTKLSDHIEQRLSERLEQDRQQRASASGKVAEEVPGVKGLTVR
VVSSAERILQVQPRFRDFFKQEKYPGEFPYKSKAILLFQKIEGVDVCLFAMYVQEYGSDC
PSPNQRHVYLAYIDSVKYFRPEIKSASGEALRTFVYHEILIGYLDYCKKRGFVSCSIWAC
PSTKRDDYVLYCHPTVQKMPKSDKLRSWYQNLVKKAVKEGVVVERNTLSDFFLQPTNECK
ANISAACLPYCENDFWPGEAERLLEKKDDNTSQKKETQVGRLLRVAKRDDRKGNLEDILL
VHKLGERMRTMKEDFIMLCLQQFCKHCHQPIISGKSWVCTSCKNFHLCDKCHAEEQNTAQ
KDRHPATTKQKHAFQRMEVEPLPETDDGDPTMESKYFDSRIDFLKHCQDNQFQFDTLRRA
KHSTMMILYYLHNSTCSACHRAVDQCLVWRCLECLGCTFCDQCYKQNGQSLHSHELRQIH
TSETLQKHTLQDYIDGLLHASRCYDPRNCTHPVCLTLKKLFFHGVRCDIRARNWSGCNKC
VFMWKLLLCHSKDCNDVNCSVPRCRDIKAYIAEKLKVVGPVL
NT seq 3729 nt NT seq  +upstreamnt  +downstreamnt
atgatgactcaaaccctgcaagggaaagttatggcctacacaccaagcagctttcctgtt
cagcaacagatcttgccggaggatattgaaatgcttcagctggataacatgaaccagaat
acctctccgattcgggccatcattattgaaaaaattgaagcatgcctgagaaacatggaa
gaattttgtgacttgtgcccagattcatgtctgaaagcttcaagaatcattgacaacatg
ctctacaaaaatgctccacagctccatttttacttggatcttgaaacagtagaaggcagg
gtgaatgatttgctcagatcttttccgtatagaaagcaaagagatccatgtatatcttca
gcagttccatcaacaaaagatttgcggcagctgcctgggatacagatgacagactctagt
gtctatcataatagagttgcccctgcttttactaatttgcctgcacattcaggagatgta
cctccacatactgtgttcacttctcagagatatgtaccacagaatcacaacatggctgct
gctaatttagctctagttgaaaggcctgaaagctttatgagcaccgtagttgctccatct
gtgtcaggacttcctaactgtatttcaggccttggtgggattgatagtgctggattgcaa
aatggctatttgaaggaccattttccagccgtgtgtgatccaaccacaagttcgggtgca
atgataagatcatcagtggactctgtctctaaagcaagtgggcaaaaactctttacccgt
gaagaacaattgtttcaacaatacagagaatatgagaaagagttagatggtgcatggagc
cacccagcagagaaggcagttcattcaaataggacaactcaaagcaatgaaatatatttc
aaagaagaatgtcgacctgacacattcatggaaatgaaagaaaactattggcacacctcg
gactctagagattcgtgcagggagatatactcaaatttaagcacacccaatgctcagtat
cagtgcttcatgtctgattgtgatcctcgtgaccctgagagagaaattgttgagagatct
gaacagacatcaaatagcacagtatcaaagccaacttcacctatttcagatgaatcttct
ggcaagcgtccagcaaaacgcctgaaggctgatgctcccactcttgtcaatgtcaatcaa
gtagagagttcaaaggatcaaaaacctgttacgaatgagaatcatgtatctggtggtgaa
acagtacaatcagaaatcacagaattacctgcaaaatcaccttgcagttcattgggagac
attaatactgacagcaataatatgcttgaacagggcagtgaagatgcacctaacacggag
cttgttaaggaagaggaattgtactgtgcaaagggtgacattgagatgaatgaggctaat
actgttgcatttgatcagacaccaagaggggtcagtttaagtacaaggagaaagagaggg
gcttctatactatatgcattaactgctgaggagcttagagatcacatgagtagtctaata
aaccagcatacttgtctgggcaaagtgatatctcaagaattcccatcaattgacggattg
cctgatcagaatacatgcagtttgtgtgggatggagaggcttctttttgaacctcctcca
cgattttgtggtctctgtttcaaaataataaattctgcagggtgctattatgttgaagtt
gaaaatggaattgagaaaacttctatatgtagcaaatgccaccatcttagcagttcaaga
gctaaatatcagaagaaatttaattatgcagaaacagatgctgaggctgaatggtgggtc
cagtgcgacaagtgcaaagcttggcagcatgaaatctgtgctctttttaacagaaagtgt
gaaggggcaaaggctgagtatacttgcgcaaaatgttttttgaatgaaaaggatagcgga
gatattcaggcactggagtcatccactgttcttggggcacaggagttaccaagaactaag
ttaagtgatcatattgagcaaagactttcagagaggcttgagcaggacaggcaacagagg
gcgagcgcctctggaaaagttgctgaagaggtaccaggtgtgaaaggtcttacagttaga
gtagtttcttcagctgaaagaatactacaagtccaaccacgttttcgtgatttttttaaa
caagaaaagtatcctggggagtttccatacaaatcgaaggccattctgttgtttcaaaag
attgaaggtgtggatgtttgcctgttcgccatgtatgtacaagagtacggttcggattgc
ccatcaccaaatcagagacatgtttatcttgcgtatatcgattctgtcaaatatttccgg
cctgaaatcaaatctgcaagtggagaagctctccgcacctttgtgtatcatgaaattttg
attggttatctggactactgcaagaaacgaggatttgtaagctgttccatatgggcttgc
ccatctacgaagcgtgatgattatgttttatattgtcatccaacagtacaaaagatgccc
aagtctgacaagcttcgaagctggtaccagaacttggtcaagaaggccgttaaggagggc
gtggttgtggagcgtaatacactctccgatttcttccttcagcctacaaatgagtgcaag
gccaatatttcagcagcatgcttgccatattgtgagaatgatttctggcctggagaagca
gagaggctccttgagaagaaagatgataatacttcacagaagaaagagacacaggtagga
aggctcttgcgtgttgccaaacgcgatgacagaaaaggaaatcttgaggatattttgctt
gtgcacaagcttggggaaaggatgcgcaccatgaaagaagatttcattatgctttgtctg
caacagttttgcaagcactgtcaccagcctatcatatctggcaaaagttgggtttgcact
agctgtaaaaatttccatctttgtgacaagtgtcatgcagaggagcagaatacggcacaa
aaggacaggcatccggccaccacaaaacagaagcatgcatttcaaagaatggaggtagaa
cctcttccggagactgatgatggagatccgacaatggaaagtaagtattttgacagcagg
atcgatttcttgaagcactgccaagacaatcaattccagtttgataccctccggcgggca
aagcactctacaatgatgattctgtattatctacacaattcgacctgctctgcttgccat
cgtgctgtggaccaatgcttggtgtggcggtgcctagagtgcctgggctgcaccttttgt
gatcaatgctataaacaaaatggtcaaagtttgcatagtcatgaattgaggcagattcac
actagtgaaactttgcagaagcacactctacaggattacattgatggtcttctgcatgca
tcgaggtgctatgatccacgtaactgcacccatccagtctgtttaaccctgaagaaattg
ttcttccatggtgtacgatgtgatatccgtgcccgcaactggagtggttgcaataagtgt
gtctttatgtggaaacttctgctctgccactcaaaagattgcaacgatgtaaactgttca
gttcctagatgcagggatataaaggcatatatagctgaaaagttgaaggttgttggtcct
gtgttgtag

DBGET integrated database retrieval system