KEGG   Sorghum bicolor (sorghum): SORBI_08g022020Help
Entry
SORBI_08g022020   CDS       T01086                                 

Gene name
SORBIDRAFT_08g022020, Sb08g022020
Definition
(RefSeq) hypothetical protein
Organism
sbi  Sorghum bicolor (sorghum)
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
NCBI-GeneID: 
UniProt: 
Position
8
AA seq 890 aa AA seqDB search
MPAPPDPPPLPAPAPDPDPSDPAAAPAPAAADEEEDDDRVFLVPLRWWKEAQEGSAIEAP
GLPYTATPAGPASYGMRVLSMFLSDQTYTLRRADELLEQTASASARSYALLPADLFAKAR
DWYIDSAKSAGKNVSPAGDSVNIYPIMLRVSATRGTYTLTVKIGKKDNSTENFKRANKIL
TADSEPVHIWDFSGRTTYIVMNELNRSPHDSKSADQEMPLQIHIYDLSEPMVNGSDGKRD
ELALTLGGSSFSNGGTMNMDVDSSSGSSKQVGSGLTGLDNLGNTCFMNSAVQCLAHTSKL
VDYFLGDFHKEINPHNPLGMKGELACAFGDLLRKLWAIDRTPVAPRQFKSRLGRFAPQFS
GFNQHDSQELLAFLLDGLHEDLNRVKCKPYSEAKDSDGRPDEEVADEYWGNHLARNDSII
VDICQGQYKSTLVCPICKKVSVTFDPFMYLSLPLPTTTMRTMTITVFSTDGTSGPSPYTI
SVPKSGDTRTLINTLSNACSLRDDERLLVAEVYNNSLIRYLDEPSEVISLIRDGDRLVAY
RLPKDNEDAPIVVFRNQRMESSLANFGRKSWKTFGTPLVSSLPDTITGSTICNLFLKVMT
PFRVSRDDVPAAVKTVGESSLVDEIADSNMSADASEPTTINNNSVEDETGTEDVMQFFLT
NERFPDQRMKIEMDLSITVKDPHKRLHVAVCWEDNGLDQYDLDSLDSLPEVYKAVLFSRR
PQDTCSLYACLEAFIKEEPLGPEDMWYCPGCKEHQQASKKLDLWRLPEILIIHLKRCSYS
RYTKYKLETFVDFPIHDLDLSKYIGHRCQDVPHNYRLYAISNHYGSLGGGHYTAYVYHEG
KKGWYDFDDRHVGPITEDSIKTSAAYVLFYRRIQEDSLDTGTHIDSDIPT
NT seq 2673 nt NT seq  +upstreamnt  +downstreamnt
atgcccgcgcccccggacccgccgccgctccccgcgccggctccggacccggacccgtcg
gatcccgccgccgcgccggcccccgccgccgccgatgaggaggaggacgacgaccgcgtc
ttcctcgtgcccctcaggtggtggaaggaggcgcaggagggatcggcgatcgaggcgccc
gggctaccctacacggccacgccggctggacctgcctcctacggcatgagggtgctgagc
atgttcctctccgaccagacatacaccctccgccgcgccgacgagctcctcgagcagacc
gcctccgcttccgccaggagctacgcgctcctcccggccgacctcttcgccaaggcgcgg
gactggtatattgattctgccaaatctgctggcaaaaatgtgtcacctgctggtgactca
gtaaatatttaccccataatgctaagagtttcagccaccagaggtacatatacactaaca
gtgaagattggcaaaaaggacaactcaactgagaactttaagagagcaaacaagattctg
actgcagactctgagccggttcacatatgggatttctctgggcggacaacatacatagtt
atgaatgaattgaaccggtcgccccatgactcaaaatctgcagatcaggagatgcctcta
caaatacacatttatgatttgtcagaacctatggttaatggttctgatgggaaaagagat
gagttagcattaacattgggtggctcaagttttagcaatggtggtactatgaacatggat
gtggattcatcaagtggaagctctaagcaagttggatctggtctaacaggattagacaat
ctgggaaacacatgtttcatgaacagtgcagtccagtgcttggctcatacttcaaagctg
gttgattatttccttggtgatttccataaagaaataaacccacataacccactggggatg
aagggcgaacttgcatgcgcattcggtgatttgttgaggaagctatgggctattgataga
acccccgttgcacctcgccaattcaagtccagacttggacgctttgctccccaattcagt
ggctttaaccaacatgattcacaggagcttcttgctttcctattggatggactccatgaa
gatttgaaccgtgtgaaatgtaaaccatattctgaagcaaaggattcagatggccgtccg
gatgaagaggtcgcagatgagtactggggcaatcatttagcccgaaacgattctatcata
gttgatatctgccagggtcagtacaagtcaacattagtttgccccatctgcaagaaagtt
tctgtaacatttgacccgttcatgtatttgtctttgcccctgcctacaacaacaatgaga
acaatgaccataacagtcttcagcactgatgggaccagtgggccatctccttacactatt
agtgtaccaaaatctggagatacaaggacccttattaatacgttaagcaatgcttgttcg
ttgagagatgatgagcgcctcctagttgccgaggtctacaacaattcccttattcggtac
ttggacgaaccttctgaagtcatctccttgatcagagatggagatcgtttggttgcatat
cggcttcctaaagacaatgaagatgctcctattgtggtgttcagaaaccagcgtatggag
tcgtcccttgccaattttgggcggaagtcatggaagacttttggcactccgcttgtgtca
agtcttcctgataccataactggaagtactatttgcaatcttttcctaaaggttatgact
ccattcagagtatcaagagatgatgttcccgctgctgttaaaacagttggcgaaagcagt
ctggttgatgaaattgcagatagcaatatgagcgctgatgcctcagagcccaccactata
aataacaattctgtcgaggatgaaacagggactgaagatgtgatgcaatttttcctgact
aatgagagattcccagaccaacgcatgaagatagaaatggatctatccattacggtgaaa
gatccacataagcgtctgcatgtggctgtgtgttgggaggacaatggactggatcaatat
gatcttgattctttggattctcttccagaagtttacaaagcagtactattttctaggagg
ccacaggacacatgttctctatatgcatgtctggaagcttttattaaggaagaaccatta
ggcccagaagacatgtggtactgcccaggttgtaaagagcatcaacaagctagtaagaag
ttagacctttggagattacctgaaatccttataatacacctgaaaagatgttcgtacagt
cggtacaccaaatacaaattggagacatttgtggacttcccgattcatgatcttgacctg
tcaaagtatatcggtcacagatgccaagatgttcctcacaattatcgactgtatgctatt
agcaaccactatggaagcttgggtggtggtcactatacagcttatgtttatcatgaagga
aaaaaggggtggtatgatttcgatgaccgtcatgtgggtcctataaccgaggacagtata
aagacatcggcggcttatgttcttttttaccggcggatacaggaggatagcttagataca
ggtacacacatagattctgacattccaacttga

DBGET integrated database retrieval system