KEGG   Sorghum bicolor (sorghum): SORBI_09g001670Help
Entry
SORBI_09g001670   CDS       T01086                                 

Gene name
SORBIDRAFT_09g001670, Sb09g001670
Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:sbi00520]
Metabolism; Glycan biosynthesis and metabolism; Glycosaminoglycan degradation [PATH:sbi00531]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - globo series [PATH:sbi00603]
Metabolism; Glycan biosynthesis and metabolism; Glycosphingolipid biosynthesis - ganglio series [PATH:sbi00604]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:sbi00511]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 546 aa AA seqDB search
MPLNLHAYLLSALLLLAGAAAAAAARHHASPAANATSSSEPVYLWPLPKSVSSGSRTLTV
DPDLALDPQGPGGRSPAVAEAFQRYRGHVFTPWAHAARPRGARYDVTRLTVVVNSANDTL
ALGVDESYAIYVGAAGGVNSIVGGAIIEANTIYGAIRGLETFSQLCVFNYDTKNIEVRNA
PWHIQDEPRFAFRGLLLDTSRHYLPVDVIKQVIDSMSFAKLNVLHWHIIDEESFPLEVPT
YPNLWKGSYSKWERYTVEDARDIVNYAKKRGINVMAEIDVPGHAESWGNGYPKLWPSPNC
TEPLDVSSNFTFEVISGILSDMRKIFPFGLFHLGGDEVYTGCWNTTPHVRQWLNEHNMTT
KEAYKYFVLKAQQLAIKLNWIPVNWEETFNSFAENLNPLTVVHNWLGPGVCPKVVAKGFK
CIMSNQGVWYLDHLDVPWEDVYSGEPLDGISDKDQQKLVLGGEVCMWGETADTSDVLQTI
WPRAAAAAERLWSQLEAITAQDVETTVLSRLHYFRCLLNHRGIAAAPVTNYYARRPPIGP
GSCFVQ
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcaacctccacgcttacctcctctccgccctcctcctcctcgccggcgccgcc
gccgccgccgcggcgcggcaccacgcgtcgccggccgcgaacgcgacctcctccagcgag
cccgtctacctctggcccctgcccaagagcgtctcgtcggggtccaggaccctgacggtg
gacccggacctcgcgctcgacccgcagggccccggcggccgctccccggccgtggccgag
gcgttccagcggtaccggggccacgtgttcacgccgtgggcgcacgccgcgcgcccgcgc
ggggcgcggtacgacgtcacaaggctcaccgtcgtcgtcaactccgccaacgacacgttg
gcgctgggcgtggacgagagctacgccatctacgtcggggcggccggcggcgtcaattcc
atcgtcggaggagcaatcattgaggcaaacacaatatatggagctattcgagggctggag
acattcagtcaactttgtgttttcaactatgacaccaaaaatattgaagtgcgcaatgcc
ccatggcatattcaagatgagccccgctttgcttttcgtgggctgctcctagacacctca
cggcattatcttccggttgatgttattaagcaagtgatcgactctatgtcatttgctaag
ctgaatgttcttcattggcatatcatcgatgaggaatcctttccattggaggtgccaaca
tatccaaacctttggaaaggttcgtactccaaatgggagcgctacaccgtggaagatgca
cgtgatattgtgaactacgctaagaaaagaggtatcaatgtcatggcagaaattgacgtg
cctggtcatgcagaatcatggggaaatggctacccaaagctctggccttctcccaattgt
acagagccattagatgtctctagcaatttcacatttgaagtaatttctggaattttgtct
gatatgaggaaaatctttccattcgggctgtttcacttgggtggcgatgaagtatataca
gggtgctggaacacaacacctcatgtgaggcagtggcttaatgagcacaacatgaccaca
aaggaggcttataaatactttgttctgaaggcccaacagttggcaattaagctaaactgg
attcctgtgaattgggaagaaaccttcaattcattcgcagaaaatctcaatcctcttaca
gtggtgcacaattggctggggcctggagtctgccctaaggttgtggcaaagggtttcaaa
tgtataatgagcaatcaaggtgtctggtaccttgatcatcttgatgttccctgggaagat
gtctacagtggcgagccactagatggcatcagtgacaaagaccagcaaaagctagtactt
ggtggggaagtttgcatgtggggtgagacagcagacacatccgacgttctacaaacaata
tggccccgagcagctgcagcagcagagcgtctgtggagtcaattggaggccataaccgcc
caagacgtggaaacaaccgtcctgtcacggctacactatttcagatgcctgctgaatcac
cgtgggattgctgcggctccagtcacaaactactatgctaggaggcccccaatcggccca
ggttcatgctttgttcagtaa

DBGET integrated database retrieval system