KEGG   Sorghum bicolor (sorghum): SORBI_09g001670Help
Entry
SORBI_09g001670   CDS       T01086                                 

Gene name
SORBIDRAFT_09g001670, Sb09g001670
Definition
hypothetical protein
Orthology
K12373  
hexosaminidase [EC:3.2.1.52]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Other glycan degradation
Amino sugar and nucleotide sugar metabolism
Glycosaminoglycan degradation
Glycosphingolipid biosynthesis - globo series
Glycosphingolipid biosynthesis - ganglio series
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Carbohydrate metabolism
   00520 Amino sugar and nucleotide sugar metabolism
    SORBI_09g001670 (SORBIDRAFT_09g001670)
  Glycan biosynthesis and metabolism
   00531 Glycosaminoglycan degradation
    SORBI_09g001670 (SORBIDRAFT_09g001670)
   00603 Glycosphingolipid biosynthesis - globo series
    SORBI_09g001670 (SORBIDRAFT_09g001670)
   00604 Glycosphingolipid biosynthesis - ganglio series
    SORBI_09g001670 (SORBIDRAFT_09g001670)
   00511 Other glycan degradation
    SORBI_09g001670 (SORBIDRAFT_09g001670)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.52  beta-N-acetylhexosaminidase
     SORBI_09g001670 (SORBIDRAFT_09g001670)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 546 aa AA seqDB search
MPLNLHAYLLSALLLLAGAAAAAAARHHASPAANATSSSEPVYLWPLPKSVSSGSRTLTV
DPDLALDPQGPGGRSPAVAEAFQRYRGHVFTPWAHAARPRGARYDVTRLTVVVNSANDTL
ALGVDESYAIYVGAAGGVNSIVGGAIIEANTIYGAIRGLETFSQLCVFNYDTKNIEVRNA
PWHIQDEPRFAFRGLLLDTSRHYLPVDVIKQVIDSMSFAKLNVLHWHIIDEESFPLEVPT
YPNLWKGSYSKWERYTVEDARDIVNYAKKRGINVMAEIDVPGHAESWGNGYPKLWPSPNC
TEPLDVSSNFTFEVISGILSDMRKIFPFGLFHLGGDEVYTGCWNTTPHVRQWLNEHNMTT
KEAYKYFVLKAQQLAIKLNWIPVNWEETFNSFAENLNPLTVVHNWLGPGVCPKVVAKGFK
CIMSNQGVWYLDHLDVPWEDVYSGEPLDGISDKDQQKLVLGGEVCMWGETADTSDVLQTI
WPRAAAAAERLWSQLEAITAQDVETTVLSRLHYFRCLLNHRGIAAAPVTNYYARRPPIGP
GSCFVQ
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgcccctcaacctccacgcttacctcctctccgccctcctcctcctcgccggcgccgcc
gccgccgccgcggcgcggcaccacgcgtcgccggccgcgaacgcgacctcctccagcgag
cccgtctacctctggcccctgcccaagagcgtctcgtcggggtccaggaccctgacggtg
gacccggacctcgcgctcgacccgcagggccccggcggccgctccccggccgtggccgag
gcgttccagcggtaccggggccacgtgttcacgccgtgggcgcacgccgcgcgcccgcgc
ggggcgcggtacgacgtcacaaggctcaccgtcgtcgtcaactccgccaacgacacgttg
gcgctgggcgtggacgagagctacgccatctacgtcggggcggccggcggcgtcaattcc
atcgtcggaggagcaatcattgaggcaaacacaatatatggagctattcgagggctggag
acattcagtcaactttgtgttttcaactatgacaccaaaaatattgaagtgcgcaatgcc
ccatggcatattcaagatgagccccgctttgcttttcgtgggctgctcctagacacctca
cggcattatcttccggttgatgttattaagcaagtgatcgactctatgtcatttgctaag
ctgaatgttcttcattggcatatcatcgatgaggaatcctttccattggaggtgccaaca
tatccaaacctttggaaaggttcgtactccaaatgggagcgctacaccgtggaagatgca
cgtgatattgtgaactacgctaagaaaagaggtatcaatgtcatggcagaaattgacgtg
cctggtcatgcagaatcatggggaaatggctacccaaagctctggccttctcccaattgt
acagagccattagatgtctctagcaatttcacatttgaagtaatttctggaattttgtct
gatatgaggaaaatctttccattcgggctgtttcacttgggtggcgatgaagtatataca
gggtgctggaacacaacacctcatgtgaggcagtggcttaatgagcacaacatgaccaca
aaggaggcttataaatactttgttctgaaggcccaacagttggcaattaagctaaactgg
attcctgtgaattgggaagaaaccttcaattcattcgcagaaaatctcaatcctcttaca
gtggtgcacaattggctggggcctggagtctgccctaaggttgtggcaaagggtttcaaa
tgtataatgagcaatcaaggtgtctggtaccttgatcatcttgatgttccctgggaagat
gtctacagtggcgagccactagatggcatcagtgacaaagaccagcaaaagctagtactt
ggtggggaagtttgcatgtggggtgagacagcagacacatccgacgttctacaaacaata
tggccccgagcagctgcagcagcagagcgtctgtggagtcaattggaggccataaccgcc
caagacgtggaaacaaccgtcctgtcacggctacactatttcagatgcctgctgaatcac
cgtgggattgctgcggctccagtcacaaactactatgctaggaggcccccaatcggccca
ggttcatgctttgttcagtaa

DBGET integrated database retrieval system