KEGG   Sorghum bicolor (sorghum): SORBI_09g002320Help
Entry
SORBI_09g002320   CDS       T01086                                 

Gene name
SORBIDRAFT_09g002320, Sb09g002320
Definition
hypothetical protein
Orthology
K05857  
phosphatidylinositol phospholipase C, delta [EC:3.1.4.11]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Inositol phosphate metabolism
Metabolic pathways
Phosphatidylinositol signaling system
Class
Metabolism; Carbohydrate metabolism; Inositol phosphate metabolism [PATH:sbi00562]
Environmental Information Processing; Signal transduction; Phosphatidylinositol signaling system [PATH:sbi04070]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 602 aa AA seqDB search
MTTTYRVCCFLRRFRAASNEPSEAVRDVFQAYADGGGVVGEEALRRLLREVQGETEAGAD
AAAKEVMAFAAEQRLLKKGGLTAEGFHRWLFSDANAALDPRRGVYQDMGLPLSHYFIYTG
HNSYLTGNQLSSGCSERPIVKALHDGVRVIELDLWPNAGKDDVEVLHGRTWTSPVELIKC
LEAIKEHAFVTSPFPVILTLEDHLTPDLQANVAKMLKETFGEMLYVSESEKMAEFPSPDE
LKGKIIISTKAPKEYLQTKSGKEEAEEGVWGEEISDDKTTAHQMSEQFSGKYSAAAEEEA
AAGAEEEAAEAEAEKKARQGTDNEYRRLIAIQLTRRKHDMEQDLRVDPDKVTRLSLGEKA
FEKAIVSHGDHIVRFTQRNLLRIFPRSTRITSSNYNPLMGWRYGVQMVAANMQGHGRKLW
LTQGMFRANGGCGYVKKPDILMNSAAADDPAGGIGKLFDPTRADLPVKTRLKVTVYMGDG
WRFDFRKTHFDRCSPPDFYVRVGIAGVAADMRMEQTRVVMDSWIPAWDHEFGEFPLAAPE
LALLRVEVHESDNHQKDDFGGQTCLPVWELRPGIRSVRLADHKGQPLRSVKLLMRFEFFS
SP
NT seq 1809 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgacgtacagggtctgctgcttcctgcggcggttccgggcggcgtcgaacgag
ccgtcggaggcggtgagggacgtgttccaggcgtacgccgacggcggcggcgtggtcggg
gaggaggcgctgcggaggctcctgcgggaggtgcagggggagacggaggccggcgccgac
gcggcggccaaggaggtgatggcgttcgcggcggagcagaggctgctcaagaagggcggc
ctcaccgccgagggcttccaccgctggctcttcagcgacgccaacgccgccctcgacccg
cgccgaggggtttaccaggacatgggcttaccactgtcgcactacttcatctacacgggc
cacaattcgtacctgacggggaaccagctgagcagcgggtgcagcgagaggcccatcgtg
aaggccctccacgacggcgtccgggtcatcgagctggacctctggcccaacgccggcaag
gacgacgtcgaggtcctccatggcaggacatggacgtcgccggtggagctgatcaagtgt
ctggaggccatcaaggagcacgccttcgtgacttcacccttccccgtcatcctcaccctg
gaagatcacctcaccccggacctccaagccaatgtcgccaagatgctgaaggaaaccttc
ggggagatgctgtacgtgtcggagtcggagaagatggcggagttcccttcccccgacgag
ctcaaaggcaagatcatcatctccaccaaggcgccaaaggagtacctccagaccaagagc
ggcaaggaggaggcggaggagggcgtctggggggaggagatctccgacgacaagaccacc
gcccatcagatgtcggagcagttcagtggcaagtactcggcggcggcggaggaggaggcc
gccgccggcgccgaggaagaggcggcggaagccgaggcggagaagaaggcgcggcagggg
acggacaacgagtaccggcgtctcatcgccattcagctcaccagacggaagcacgacatg
gagcaggacctacgggtcgaccccgacaaggtgacgcgcctcagcctcggcgagaaggcg
ttcgagaaggccatcgtctcccatggcgatcacatcgtcaggttcacgcagcggaatctg
ctgcgcatcttcccgcggtcgacgcgcatcacgtcgtccaactacaaccctctcatgggg
tggaggtacggagttcagatggtggcggcgaacatgcagggccatgggaggaagctctgg
ctgacgcaagggatgttccgggcgaacggcggctgcggctacgtcaagaagcccgacatc
ctgatgaacagcgccgccgccgacgatcccgccggaggtatcggcaagctgttcgaccca
acacgagcggatctgccggtgaagacgaggctgaaggtgacggtgtacatgggagacggg
tggcggttcgacttccgcaagacgcacttcgacaggtgctcgccgccggacttctacgtg
agagtgggcatcgccggcgtggcggcggacatgaggatggagcagacgcgggtggtgatg
gacagctggatccccgcgtgggaccacgagttcggcgagttcccgctggcggcgccggag
ctggcgctgctgagggtggaggtgcacgagtcggacaaccaccagaaggacgacttcggc
gggcagacatgtctgccggtgtgggagctccgccctgggatccgctccgtcaggctcgcc
gaccacaagggccagccgctgcgatccgtcaagctgctcatgcgcttcgagttcttctcc
tccccctga

DBGET integrated database retrieval system