KEGG   Sorghum bicolor (sorghum): SORBI_09g003710Help
Entry
SORBI_09g003710   CDS       T01086                                 

Gene name
SORBIDRAFT_09g003710, Sb09g003710
Definition
hypothetical protein
Orthology
K13082  
bifunctional dihydroflavonol 4-reductase/flavanone 4-reductase [EC:1.1.1.219 1.1.1.234]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Flavonoid biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Flavonoid biosynthesis, naringenin => pelargonidin
Class
Metabolism; Biosynthesis of other secondary metabolites; Flavonoid biosynthesis [PATH:sbi00941]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 362 aa AA seqDB search
MAEAIEGGASATKGPVVVTGASGFVGSWLVMKLLHAGYTVRATVRDPANVEKTKPLLDLP
GATERLSLWKADLAVEGSFDDAIRGCTGVFHVATPMDFESKDPENEVIKPTVEGMISIMQ
ACKEAGTVRRIVFTSSAGTVNVEERRKPVYDEDSWTDVDFCRRVKMTGWMYFVSKTLAEK
AAMAYAAEHGVDLITVIPTLVVGPFLSAGMPPSLVTAMALVTGNEAHYSILKQVQFIHLD
DLCDAHLFLFEHPAAAGRYVCSAADATIHGLAAMLRERYPEYNIPRRFPGIDDDLQLVRF
SSKKLLDHGFTFRYTTMENMYDAAIRTCREKGLIPLATAGGEGGSASAGAPGPGGTDAAI
SA
NT seq 1089 nt NT seq  +upstreamnt  +downstreamnt
atggcggaggcgattgagggaggcgcgagcgcgacgaaagggccggtggtggtgacgggg
gcgtcgggcttcgtcggctcctggctcgtcatgaagctcctccacgccggctacaccgtc
cgggcgaccgtgcgcgatcccgcgaacgtcgagaagacgaagccattgctggaccttccc
ggagcaacggagcgcctgtccttgtggaaagccgacctggcggtggaaggcagcttcgac
gacgccatcaggggctgcaccggcgtcttccacgtcgccacgcccatggacttcgagtcc
aaagaccctgagaatgaggtaatcaagccgactgtcgaagggatgataagcatcatgcaa
gcctgcaaggaggccggcaccgtacgtcgcatcgtcttcacttcctccgctgggactgtc
aacgtcgaggagcggcggaagcccgtctacgacgaggacagctggaccgacgtcgatttc
tgccgtcgcgtcaagatgaccggatggatgtacttcgtgtctaaaaccctagcggagaag
gcggccatggcgtacgcggcggagcacggcgtggacctcatcaccgtcatcccgacgctc
gtggtcggccctttcctcagcgccggcatgccgcccagccttgtcacggcgatggcgctc
gtcaccgggaacgaggcccactactcgatcctgaagcaggtgcagttcatccacctcgac
gacctctgcgacgcccacctgttcctcttcgagcacccggccgccgccgggcgctacgtc
tgctccgcggccgacgccaccatacacggcctcgccgccatgctgagggagaggtacccc
gagtacaacatcccgcggaggttccctgggatcgacgacgacctccagctcgtgcgcttc
tcgtccaagaagctcctagaccatgggttcactttcaggtacacgacgatggagaacatg
tacgacgccgccatccggacatgccgggagaagggcctcatccccctcgccactgccgga
ggggaaggtggctctgcctccgcgggggcacccggtcccggtgggacagatgcggcaatt
agtgcttaa

DBGET integrated database retrieval system