KEGG   Sorghum bicolor (sorghum): SORBI_09g004170Help
Entry
SORBI_09g004170   CDS       T01086                                 

Gene name
SORBIDRAFT_09g004170, Sb09g004170
Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    SORBI_09g004170 (SORBIDRAFT_09g004170)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     SORBI_09g004170 (SORBIDRAFT_09g004170)
Transfer RNA biogenesis [BR:sbi03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    SORBI_09g004170 (SORBIDRAFT_09g004170)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 439 aa AA seqDB search
MPLALQLRLPLPRVLVVQRCRCRLPPSRLSVRAEAAAGVAVAAAAAPSSVVHDELCMLPF
SPELASHHRELAAAVASVERACRLCVDVKASLLSGDRKFLEKNDETPVTIADFGVQALIS
FELQQLFPSIPLVAEEDSACLRSLNADESNSNELVESISSFVAERVSNSGSPLSHADVLS
AIDRGGKDAVSFDPNPATYWVLDPIDGTKSFLKGADDSLYVVGLALVVDGKLAVGVMGCP
NWTDGITDKNNDESLAAPPGRGILMVSHVGCGTWSRPLSSEIDQFTTALDAWKRCFVDPC
SIAHMARYCIVDSHTWDMMPLSLYFNSTMDQSDPRDENRILLQNSCGGSLSKYLMVASGR
MSVFILLARAEKQIKAWDHAVGVICVQEAGGQTCDWRGEPLDFAADQTGRRIIYPWGGVL
ATNCALHDELVEMITATYN
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcgccctccagctgcggcttccactgccacgtgtcctcgtcgtccagcggtgc
aggtgcaggctgcccccctcacgcctctctgtaagggcagaagcggcggccggggtggca
gtggcggcagcggcggcgccatcgtcagtcgttcatgatgaactgtgcatgctacccttc
tcgccggagctcgcttcccaccaccgtgagctcgccgctgctgtcgcctccgtcgagcga
gcctgccgcctatgtgtcgatgtgaaggcatcgctgctttcaggtgacaggaagtttctt
gaaaagaatgacgaaactcctgtaacaattgctgattttggtgttcaggcccttattagc
tttgagctacagcaattgtttccatcaatacctctggtggcagaagaggactcggcatgc
ctacggtcgttgaatgctgatgaaagcaatagtaatgaacttgttgagtcaatttcaagt
tttgttgcagaaagagtcagtaacagtggttcaccattaagtcatgctgatgtgttgagc
gcaattgatagaggaggcaaggatgctgtctccttcgatccaaatcccgctacttattgg
gtgcttgacccgatcgatggtactaagagtttcttgaaaggagcagatgattccctgtat
gtggtgggcttggctcttgtggtggatggaaagttagcagtaggagtcatgggatgtccg
aattggactgatggcatcacagacaaaaacaatgatgaatcccttgcagcccctcctggt
cgtggtatccttatggtgtctcatgtaggctgtggcacttggtctaggcccttgtcttct
gagattgaccagttcactacagcactggatgcttggaagagatgctttgttgatccctgt
tcaattgcacacatggcacgctactgcattgttgatagccatacatgggatatgatgcca
ctgtctctctacttcaattcaacaatggatcaatctgatcccagagatgagaatagaatt
cttctccaaaattcttgtggtggcagcttgtccaagtatctcatggtggcctccgggaga
atgtcagtttttatcctcctagcacgagccgaaaaacaaatcaaggcttgggaccatgca
gttggggtaatttgtgttcaggaagctggagggcagacatgtgactggagaggggaacct
ttggattttgctgctgaccagacagggcgcagaatcatctacccttggggtggtgttctg
gctacaaactgtgctcttcatgacgagcttgtagaaatgatcacagcaacttataattag

DBGET integrated database retrieval system