KEGG   Sorghum bicolor (sorghum): SORBI_09g004170Help
Entry
SORBI_09g004170   CDS       T01086                                 

Gene name
SORBIDRAFT_09g004170, Sb09g004170
Definition
hypothetical protein
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Sulfur metabolism
Metabolic pathways
Class
Metabolism; Energy metabolism; Sulfur metabolism [PATH:sbi00920]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 439 aa AA seqDB search
MPLALQLRLPLPRVLVVQRCRCRLPPSRLSVRAEAAAGVAVAAAAAPSSVVHDELCMLPF
SPELASHHRELAAAVASVERACRLCVDVKASLLSGDRKFLEKNDETPVTIADFGVQALIS
FELQQLFPSIPLVAEEDSACLRSLNADESNSNELVESISSFVAERVSNSGSPLSHADVLS
AIDRGGKDAVSFDPNPATYWVLDPIDGTKSFLKGADDSLYVVGLALVVDGKLAVGVMGCP
NWTDGITDKNNDESLAAPPGRGILMVSHVGCGTWSRPLSSEIDQFTTALDAWKRCFVDPC
SIAHMARYCIVDSHTWDMMPLSLYFNSTMDQSDPRDENRILLQNSCGGSLSKYLMVASGR
MSVFILLARAEKQIKAWDHAVGVICVQEAGGQTCDWRGEPLDFAADQTGRRIIYPWGGVL
ATNCALHDELVEMITATYN
NT seq 1320 nt NT seq  +upstreamnt  +downstreamnt
atgccgctcgccctccagctgcggcttccactgccacgtgtcctcgtcgtccagcggtgc
aggtgcaggctgcccccctcacgcctctctgtaagggcagaagcggcggccggggtggca
gtggcggcagcggcggcgccatcgtcagtcgttcatgatgaactgtgcatgctacccttc
tcgccggagctcgcttcccaccaccgtgagctcgccgctgctgtcgcctccgtcgagcga
gcctgccgcctatgtgtcgatgtgaaggcatcgctgctttcaggtgacaggaagtttctt
gaaaagaatgacgaaactcctgtaacaattgctgattttggtgttcaggcccttattagc
tttgagctacagcaattgtttccatcaatacctctggtggcagaagaggactcggcatgc
ctacggtcgttgaatgctgatgaaagcaatagtaatgaacttgttgagtcaatttcaagt
tttgttgcagaaagagtcagtaacagtggttcaccattaagtcatgctgatgtgttgagc
gcaattgatagaggaggcaaggatgctgtctccttcgatccaaatcccgctacttattgg
gtgcttgacccgatcgatggtactaagagtttcttgaaaggagcagatgattccctgtat
gtggtgggcttggctcttgtggtggatggaaagttagcagtaggagtcatgggatgtccg
aattggactgatggcatcacagacaaaaacaatgatgaatcccttgcagcccctcctggt
cgtggtatccttatggtgtctcatgtaggctgtggcacttggtctaggcccttgtcttct
gagattgaccagttcactacagcactggatgcttggaagagatgctttgttgatccctgt
tcaattgcacacatggcacgctactgcattgttgatagccatacatgggatatgatgcca
ctgtctctctacttcaattcaacaatggatcaatctgatcccagagatgagaatagaatt
cttctccaaaattcttgtggtggcagcttgtccaagtatctcatggtggcctccgggaga
atgtcagtttttatcctcctagcacgagccgaaaaacaaatcaaggcttgggaccatgca
gttggggtaatttgtgttcaggaagctggagggcagacatgtgactggagaggggaacct
ttggattttgctgctgaccagacagggcgcagaatcatctacccttggggtggtgttctg
gctacaaactgtgctcttcatgacgagcttgtagaaatgatcacagcaacttataattag

DBGET integrated database retrieval system