KEGG   Sorghum bicolor (sorghum): SORBI_09g004260Help
Entry
SORBI_09g004260   CDS       T01086                                 

Gene name
SORBIDRAFT_09g004260, Sb09g004260
Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
mRNA surveillance pathway
Class
Genetic Information Processing; Translation; mRNA surveillance pathway [PATH:sbi03015]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 322 aa AA seqDB search
MMMTRAPMGPMEGAAVDEVVRRLVEGGRGGRQVQLSEAEIRQLCVEGKRVLLSQPNLLRI
HAPVKICGDIHGQFVDLLRLFDLGGYPPASTYVFLGDYVDRGKQSLETICLLLAYKIRYP
EKIFLLRGNHEDAKINRVYGFYDECKRRFNVRLWKIFSDCFNCLPIAALIDDKILCMHGG
LSPELTSLDQIKDIERPAEIPDYGLLCDLLWSDPSPDGEGWGESDRGVSCTFGADKLVEF
LEKNDLDLICRAHQVVEDGYEFFAQRRLVTIFSAPNYCGEFDNAGALLSIDESLMCSFQI
LKPTDMGPPHARKQIPNKPARG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgacgcgggccccgatggggccgatggaaggcgcggcggtggacgaggtggtg
cgccgcctcgtggagggcggccgcggcgggcgccaggtgcagctgtccgaggcggagatc
cgccagctctgcgtcgagggcaagcgcgtgctcctctcccagcccaacctcctccgaatc
cacgcccccgtcaagatctgcggtgatatccacggccagtttgttgaccttctgaggttg
ttcgatttgggcggttatcctccagcttcgacttacgtattcctcggagactatgtcgat
agaggcaaacagagcttggaaactatatgcttgctgctggcatacaaaatccggtacccc
gagaagattttcctgttgagggggaaccatgaggatgccaagatcaacagagtctacggt
ttctatgacgaatgtaagaggaggttcaatgttcggctgtggaagatattctccgattgc
ttcaactgccttcctattgcagcgctcattgatgacaaaatactgtgcatgcatggtggt
ctgtcacctgagttgactagtttggaccagataaaggatattgagcggcctgctgagatt
cctgattatggtctcctgtgtgatctgctgtggtctgatcctagccctgatggagaaggg
tggggggagagtgacaggggtgtttcgtgtacgtttggtgcagataaacttgtggagttt
ttggagaagaacgatctcgatcttatatgccgagctcatcaggtggttgaagatggttat
gagttctttgcacaacgaagattagtgacaatcttttcagctccaaattattgtggagag
tttgataatgctggtgccctattgagcatagatgagagcctaatgtgttcatttcagatc
ctgaaaccaactgatatgggtccaccacatgcaagaaaacaaattccgaataagccagca
agagggtga

DBGET integrated database retrieval system