KEGG   Sorghum bicolor (sorghum): SORBI_09g004260Help
Entry
SORBI_09g004260   CDS       T01086                                 

Gene name
SORBIDRAFT_09g004260, Sb09g004260
Definition
hypothetical protein
Orthology
K06269  
serine/threonine-protein phosphatase PP1 catalytic subunit [EC:3.1.3.16]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
mRNA surveillance pathway
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Genetic Information Processing
  Translation
   03015 mRNA surveillance pathway
    SORBI_09g004260 (SORBIDRAFT_09g004260)
Enzymes [BR:sbi01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.16  protein-serine/threonine phosphatase
     SORBI_09g004260 (SORBIDRAFT_09g004260)
Protein phosphatases and associated proteins [BR:sbi01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    Catalytic subunits
     SORBI_09g004260 (SORBIDRAFT_09g004260)
Transcription machinery [BR:sbi03021]
 Eukaryotic type
  RNA polymerase II system
   Other transcription-related factors
    Transcription termination factor
     SORBI_09g004260 (SORBIDRAFT_09g004260)
Spliceosome [BR:sbi03041]
 Other splicing related proteins
  Spliceosome associated proteins (SAPs)
   Other SAPs
    SORBI_09g004260 (SORBIDRAFT_09g004260)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 322 aa AA seqDB search
MMMTRAPMGPMEGAAVDEVVRRLVEGGRGGRQVQLSEAEIRQLCVEGKRVLLSQPNLLRI
HAPVKICGDIHGQFVDLLRLFDLGGYPPASTYVFLGDYVDRGKQSLETICLLLAYKIRYP
EKIFLLRGNHEDAKINRVYGFYDECKRRFNVRLWKIFSDCFNCLPIAALIDDKILCMHGG
LSPELTSLDQIKDIERPAEIPDYGLLCDLLWSDPSPDGEGWGESDRGVSCTFGADKLVEF
LEKNDLDLICRAHQVVEDGYEFFAQRRLVTIFSAPNYCGEFDNAGALLSIDESLMCSFQI
LKPTDMGPPHARKQIPNKPARG
NT seq 969 nt NT seq  +upstreamnt  +downstreamnt
atgatgatgacgcgggccccgatggggccgatggaaggcgcggcggtggacgaggtggtg
cgccgcctcgtggagggcggccgcggcgggcgccaggtgcagctgtccgaggcggagatc
cgccagctctgcgtcgagggcaagcgcgtgctcctctcccagcccaacctcctccgaatc
cacgcccccgtcaagatctgcggtgatatccacggccagtttgttgaccttctgaggttg
ttcgatttgggcggttatcctccagcttcgacttacgtattcctcggagactatgtcgat
agaggcaaacagagcttggaaactatatgcttgctgctggcatacaaaatccggtacccc
gagaagattttcctgttgagggggaaccatgaggatgccaagatcaacagagtctacggt
ttctatgacgaatgtaagaggaggttcaatgttcggctgtggaagatattctccgattgc
ttcaactgccttcctattgcagcgctcattgatgacaaaatactgtgcatgcatggtggt
ctgtcacctgagttgactagtttggaccagataaaggatattgagcggcctgctgagatt
cctgattatggtctcctgtgtgatctgctgtggtctgatcctagccctgatggagaaggg
tggggggagagtgacaggggtgtttcgtgtacgtttggtgcagataaacttgtggagttt
ttggagaagaacgatctcgatcttatatgccgagctcatcaggtggttgaagatggttat
gagttctttgcacaacgaagattagtgacaatcttttcagctccaaattattgtggagag
tttgataatgctggtgccctattgagcatagatgagagcctaatgtgttcatttcagatc
ctgaaaccaactgatatgggtccaccacatgcaagaaaacaaattccgaataagccagca
agagggtga

  All links  
No link information was found.   
DBGET integrated database retrieval system