KEGG   Sorghum bicolor (sorghum): SORBI_09g004370Help
Entry
SORBI_09g004370   CDS       T01086                                 

Gene name
SORBIDRAFT_09g004370, Sb09g004370
Definition
hypothetical protein
Orthology
K09584  
protein disulfide-isomerase A6 [EC:5.3.4.1]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Protein processing in endoplasmic reticulum
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Genetic Information Processing
  Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    SORBI_09g004370 (SORBIDRAFT_09g004370)
Enzymes [BR:sbi01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     SORBI_09g004370 (SORBIDRAFT_09g004370)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 367 aa AA seqDB search
MASPQISRRALGLLLVLATAAAAVVSPAAADDVVALTEADFEKEVGQDRGALVEFYAPWC
GHCKKLAPEYEKLGASFKKAKSVLIAKVDCDEHKGLCSKYGVSGYPTIQWFPKGSLEPKK
YEGQRSVEALAEYVNSEAGTNVKIVAIPSSVVVLTPETFDSIVLDETKDVLVEFYAPWCG
HCKHLAPVYEKLASVFKQDDGVVIANLDADKHTDLAEKYGVSGFPTLKFFPKGNKAGEDY
DGGRDLDDFVKFINEKCGTSRDSKGQLNSEAGLVASLNPLVKEFLNAAADKRKEVISKIE
EDVAKLSGSAAKHGKIYVTAAKKIMDKGSDYTKKETERLHRLLEKSISPSKADEFIIKKN
ILSTFSS
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcccctcagatctcccgcagagccctgggcctcctgctcgtcctcgccaccgct
gccgccgcggtcgtctcgccggccgccgccgacgatgtggtggccctgacggaagccgac
ttcgagaaggaggtcggccaggaccgcggtgctctcgtcgagttctacgcgccatggtgc
ggccactgcaaaaagcttgcccccgagtatgaaaaacttggtgcaagcttcaagaaggct
aaatctgtattaatcgcaaaggttgactgcgatgagcacaagggtttgtgcagcaagtat
ggagtttctgggtaccccacaattcaatggtttcccaaaggttccttggagccgaagaag
tatgagggtcagcgttctgtggaagcccttgcagaatatgttaacagtgaagcaggtacc
aatgtcaagatagttgccattccttcaagcgtcgtggttctgactccagagacttttgac
tctattgtccttgatgaaaccaaagatgtccttgttgagttctatgccccatggtgtggt
cactgcaagcatcttgctccggtttatgagaagctggcttcagttttcaagcaggatgac
ggtgttgtgattgccaatcttgatgctgacaagcacactgacttggctgaaaagtatggt
gtttctggtttccctacattgaagttcttccctaagggaaacaaggctggtgaagattat
gatggtggcagggacttggatgattttgtcaagttcattaatgagaagtgtggcaccagc
cgggattcaaagggccaactgaattcagaggctgggcttgtggcaagcttgaatcctctt
gtgaaggagtttctcaatgctgctgctgacaaacggaaggaagtcatctctaaaatagaa
gaggatgttgctaagctcagcggttctgctgccaagcacggaaagatatatgtgacagct
gcaaagaagattatggacaagggctctgactacactaagaaggagactgagaggcttcac
cgcttgctggagaagtcgatcagtccttccaaagctgatgaattcatcattaagaagaac
attctttcgacattctcttcttga

DBGET integrated database retrieval system