KEGG   Sorghum bicolor (sorghum): SORBI_09g017790Help
Entry
SORBI_09g017790   CDS       T01086                                 

Gene name
SORBIDRAFT_09g017790, Sb09g017790
Definition
hypothetical protein
Orthology
K07203  
FKBP12-rapamycin complex-associated protein
Organism
sbi  Sorghum bicolor (sorghum)
Brite
Protein kinases [BR:sbi01001]
 Serine/threonine protein kinases: Atypical group
  PIKK family [OT]
   SORBI_09g017790 (SORBIDRAFT_09g017790)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 2466 aa AA seqDB search
MKPSPHFPEIGKKPKDLIAKDHAFNIAAYISSGADVIAAALRKHVEEEARDLSGEAFLRF
MDQLYEQISSLLQSNDVTENLLALRAIDALIDMPFGEGASKVSKFASFLRNVFEVKRDPE
ILVPASAVLGHLAKAGGAMTADEVERQIKTALGWLTGDRVEYRRFAAVLILKEMAENGST
VFNVHVPEFVDAIWVALRDPKQAVREKAVEALRACLHVIEKRETRWRVQWYYRMCEAAQV
GLGRNASVHSIHGSLLAVGELLRNTGEFMMSRYREVADIVLDYLKHRDQLVRRSITSLLP
RIAHFLRDRFVTNYLKICMDHILFVLRTPDERASGFVALGEMAGALGVELVPYLPAITSH
LQDAIAPRRGRPSLEAISCVGSFAKAMGPAMEPHIRSGLLDAMFFAGLSDKLVDALESIS
TSIPSLLPTIQERLLDCISQALPKSSIRPGASVGRANRSNSLQQFVDSNSPLLVQLALWT
LANFNFKGHELLEFARESVILYLEDEDSSTRKAASLCCCKLVAHSLSASSTSQFGSNRTN
RIGGAKRRRLVEEIVEKLLMAAVADADVGVRSSVFKALYRNPAFDDFLAQADILTSIFVA
LNDEEYDVRELAISVAGRLSEKNPAYVLPALRRYLIQLLTYLDQSMDSKCREESARLLGC
LIRSCARLILPYIAPVHKALVTRLCEGTGPNANNALAAGVLATVGELAKVGGFAMRRYLP
ELMPVVVDALLDGGAVSKREVAVSTLGQIIQSTGYVIAPYNEYPPLLGLLLKLLNGELEW
STRLEVLKVLGIMGALDPHAHKRNQHNLPGQHREVLRPTIETAQHIVSMEELPTDFWPSF
SASEDYYSTVAISSLMRILRDPSLSSYHQMVVGSLIFIFKSMGLGCVPYLPKVLPELLRA
VRMCEDGGLKEFITWKLGTLISIVRQHIRKYLQDILSLISELWTSSFSLPAPNRTIQGPQ
GSPVLHLVEQLCLALNDEFRIYLLHILPSCIQVLGDAERCNDYYYVPGILHTLEVFGGNL
DEHMHLVAPVLVRLFKVELVDIRRRAIVTLTNLIPKVQVGTHVSALVHHLKLVLDGNNDD
LRKDAAEALCCLAHALGEDFTIFVPSIRKILVKHHLRYRKWDEIENRLLRRELLITENLS
VQKYTQCPPDVISDPLDDFDGTPSEIADETQRQARSHQVNDVRLRSAGEASQRSTREDWA
EWMRHFSIALLKESPSPALRTCARLAQLQPSVGRELFAAGFASCWAQMSESAQEQLVRSL
KTAFSSQNIPPEILATLLNLAEFMEHDEKPLPIDTRLLGALAEKCRAFAKALHYKEMEFE
AVCTKKMGANPVTVVESLIHINNQLHQHEAAIGILTYSQQNLEVQLKESWYEKLHRWDEA
LKAYTIKSSQAPGPLQNLDATLGRMRCLAALARWEDLSALCREQWTGAEPSARLEMAPMA
ANAAWHMGEWDHMAEYVSRLDDGDENKLRMLGNTTASGDGSSNGAFFRAVLSVRSKKYDE
ARIFVERARRCLATELAALVLESYERAYNNMVRVQQLSKLEEVIDYCTLPAESPIADGRR
ELIRNMWNERIKGTKRNVEVWQALLAVRELVLPPNEDRDTWIKFAKLCWKNGRISQARST
LVKLLQFDPESSPELTLYHAHPQVALAYLKYQYAVGDELKRRDAFSRLQELSMQLATAMG
NFPGTSANHGTMSNAGVPLIARVYLTLGTWKKALSPALDDDSIQEILISYNHATLSAKDW
GKAWHTWALFNTEVMSRYTFRGRPDIAGKYVVAAVTGYFYSIACQSTTKGVDDSLQDILR
LLTLWFNHGATSEVQTALQKGFSLVKIEMWLVVLPQIIARIHSNTRVVRELIQSLLVRIG
KGHPQALMYPLLVACKSISILRQRAAQEVVDKIRQHSGGLVDQAQLVSKELIRVAILWHE
MWHEALEEASRMYFGEHNIEGMLAVLEPLHAMLERGPETIKENAFIQAYGHELLEAHECC
SKYRATGEDAELTKAWDLYYHVFRRIDKQLPSLTTLDLHSVSPELLKCRKLELAVPGTYA
ADSPLVTIEYFVPQLIVITSKQRPRKLTIHGSDGNDYAFLLKGHEDLRQDERVMQLFGLV
NTLLENSRKTSEKDLSIQRYAVIPLSPNSGLIGWVPNCDTLHALIREYRDARKIFLNQEH
KLMLAFAPDYDHLPLIAKVEVFQHALQNTEGNDLAKVLWLKSRTSEVWLERRTNYARSLA
VMSMVGYLLGLGDRHPSNLMLDRYSGKILHIDFGDCFEASMNREKFPEKVPFRLTRMLVK
AMEVSGIEGTFRTTCENVMQVLRTNRDSVMAMMEAFVHDPLINWRLFNFNEVPQVSNYGN
AHAHTVVSSEDAVANRELMQPQRGARERELLQAVNQLGDANEVLNERAVAVMARMSDKLT
GRDFSSGSALAGAGSSTQHGSEHLASGDARDAQPALSVKVQVQKLILQATSHENLCQNYV
GWCPFW
NT seq 7401 nt NT seq  +upstreamnt  +downstreamnt
atgaagccctcgccgcacttcccggagatcgggaagaagcctaaagatttgattgctaag
gaccacgcatttaacatcgcggcttacatctcgtctggagcggatgttattgctgctgcg
ctccgtaaacatgttgaggaggaagcccgagatcttagtggtgaagcttttttaaggttt
atggatcagctctatgagcagatatctagtttactgcagagcaacgatgtcactgaaaat
ttactggctctccgtgctattgatgctttaattgatatgccctttggagaaggtgcttcc
aaagtttctaagtttgccagcttcttgagaaatgtatttgaagtgaagcgcgaccctgaa
atcctagttccagcaagtgcagtgctgggtcatttagcaaaagcggggggagcaatgact
gcagatgaagtggagcgacaaattaaaacagctttggggtggcttactggtgatcgagtg
gaatatcgccggtttgcagctgtactcattctcaaagagatggctgaaaatggatcaaca
gttttcaatgttcatgttcctgagtttgtagatgctatatgggtagcactgagagaccct
aaacaggctgttcgtgaaaaagcagttgaagccttgcgtgcttgtctccatgttattgaa
aaacgggagactcgttggcgtgtacaatggtattaccgcatgtgtgaagccgcacaagtt
ggacttggcagaaatgcttctgttcatagtattcatggctcattattggctgttggagaa
ttgctgaggaatacgggggagtttatgatgtctcgatacagagaagtggctgatattgtc
ctcgattatttaaagcatcgagatcagcttgttcgacgtagtataacatcacttcttcct
cgaattgcccacttcctgcgtgacagatttgtgactaattacctgaagatttgcatggat
catatcttgtttgttctacgtacaccagacgagcgtgctagcggctttgttgcacttgga
gagatggctggggctctgggtgttgaacttgtgccttatttaccagcaattacttcacat
ttgcaagatgcgattgctcctcgcagaggaaggccatctcttgaggcaatttcttgtgta
ggaagctttgcaaaagctatgggtcctgcaatggaacctcatattcgtagcggactgcta
gatgctatgttttttgctggtctttctgataaactggtagatgcacttgagtctataagc
acaagcatcccgtctttactacccacaatacaggagcgtttattggattgtatatctcaa
gcactaccaaagtcatcaataaggccaggtgcttctgttggtcgagcaaacaggtcaaac
agtttgcaacagtttgtggactctaatagtcctcttcttgtgcaacttgcactgtggact
ctagcaaacttcaactttaagggccatgaacttctggaattcgctagagagagtgtcata
ctttatttggaagatgaagatagcagtaccagaaaagctgcctcattgtgttgttgcaaa
ttagttgcacactccctttctgcttcctcaacttcacagttcggttcaaataggacaaat
cgtattggaggagctaagcgccgccggcttgtagaggagatagtggagaaacttcttatg
gctgcagttgctgatgctgatgttggtgttagaagttcggtcttcaaggcgttgtatcga
aatccagcttttgatgatttcttggcccaagctgacatcttgacttcaatttttgttgcc
ttaaatgatgaggaatatgatgtcagagaattggcgatttctgttgctggccgattgtct
gaaaagaatcctgcatatgtactgcctgcccttcgtcgctatcttatacagttgctcaca
tatcttgaccagagtatggatagcaagtgtagagaggaaagtgctagattattgggttgt
ttaattaggagctgtgcacggctcattcttccttacattgctccagttcacaaggcgctt
gtgactagattgtgtgaaggaacgggaccaaatgctaataatgctcttgctgcgggagtg
cttgccactgttggagaactggccaaagtgggtggctttgctatgaggcgatatcttcct
gagctgatgcctgtagttgtggatgctcttttagatggaggtgctgttagtaaaagggaa
gtggctgtgtcaactctgggacaaattatccaaagcacaggctatgttatcgccccctat
aacgagtacccgccgttgcttggcttactcttgaagttgctgaatggtgaattggaatgg
tcaactagactagaagtgctaaaggttttagggattatgggtgcattggaccctcatgca
cacaagcgaaatcagcataatctacctggtcaacatagagaggtcctacggccaacaatc
gagactgcacagcatattgtttctatggaagagttaccgactgacttctggccatctttt
tcggcatctgaggactattactcaacagttgcaattagttccctcatgcgaattcttcga
gatccttctctttcgagttatcaccaaatggtggttggctctcttatctttatttttaag
tcaatgggccttggctgtgttccatacttaccaaaggttctccctgagctattgcgtgct
gttcgcatgtgcgaggatggtggtttaaaagagttcataacctggaagcttggaacattg
atatctattgtccgtcagcacatccggaaatatttacaagacatactttcccttatctct
gagttgtggacttcctcattcagcttgcctgcaccaaatcggaccatacagggcccacag
ggttcaccggttcttcaccttgttgagcaattatgcttagctttaaatgatgagttcaga
atttatttacttcacattctaccaagttgtatccaagtcttaggtgacgctgaacgttgc
aatgattattactatgttcctggcatattacacacacttgaagtttttggtggaaatttg
gatgagcacatgcatttggttgctccagtgcttgttcgtttatttaaagtggagctggtt
gatatcagacggcgtgctattgttactttgactaatcttattcccaaggttcaggttggc
actcatgtttcggctttagtgcatcatctgaagcttgtcttagatggcaacaatgatgat
ctgcggaaagatgctgcagaagcgctctgctgcctcgcacatgcccttggagaagacttt
actatcttcgtaccatcaatacgcaaaattcttgtgaagcaccatttacggtacagaaaa
tgggatgagattgaaaatcggttactgaggcgagagctactcatcactgaaaacttgtct
gtacaaaagtacacacaatgtccacctgatgtcattagtgacccccttgatgattttgat
ggtacaccttctgagatagctgatgaaacacagcgacaagcaagaagtcatcaagtcaat
gatgtccggttgcggagtgctggtgaggcttctcagaggagtactagggaagactgggct
gaatggatgagacatttcagtattgcacttctcaaagagtcaccatctccagctttacgc
acttgtgcaaggctagctcagcttcagccttctgttggccgcgagttgtttgctgcgggt
tttgcaagttgctgggcccaaatgagtgaatctgcccaggaacaacttgtgagaagtctc
aagacagccttctcatctcaaaacattcctcctgaaattcttgctacactgctgaactta
gcagagtttatggaacacgatgagaagccgcttcctattgatacaaggctgcttggtgca
cttgctgagaagtgtcgagcatttgcaaaagccctccattataaagaaatggagtttgaa
gctgtgtgcaccaagaagatgggtgcaaatcctgttacggtggttgaatcccttattcat
attaacaatcaactacaccagcatgaggcagctattggcatattgacttactcacagcag
aatttggaagttcagttgaaagaatcatggtatgaaaaattgcaccgttgggatgaggcc
cttaaagcatacaccataaaatcatctcaagcacctggtcctttacaaaacttggatgct
acattaggtcgaatgaggtgtctagcggctttggctcggtgggaagatttaagtgcatta
tgcagagagcaatggactggtgcagaaccatctgctcgattggaaatggctccaatggct
gcaaatgctgcttggcatatgggtgagtgggaccatatggcagaatatgtttctcgcctg
gatgatggagatgaaaataagctccgtatgttgggtaacacaacggctagtggtgatgga
agcagtaatggtgctttcttccgggcagttctttcagttcgttccaaaaagtatgatgaa
gctcggatatttgttgagcgagctcggcggtgtttagctacagaacttgcagcactggta
cttgagagttatgagcgcgcttataataacatggtgcgtgttcaacaactttcaaaactg
gaagaggtgattgattactgcactcttcctgcggaaagccccatagctgacggacggagg
gaacttattcgcaatatgtggaatgaacgcattaaaggaacaaaacggaatgtggaggtc
tggcaagccctacttgcagtcagggagttggttcttcctcctaacgaagacagagacacc
tggataaaatttgctaaactttgctggaagaatggtcgtattagtcaggctagatctaca
ttagtcaaacttttacagtttgatcctgaatcttctcctgaattgacactgtatcatgca
catccacaagtagccctggcttatctaaaataccagtatgcagttggtgatgagcttaaa
agaagggatgcattttctagattgcaagagttgtctatgcagcttgctactgccatgggc
aatttccctggaacatcagcaaaccatggtaccatgtcaaatgctggagttccactcatt
gctcgtgtttatttgacacttggtacctggaagaaggcgctatcacctgcattagatgat
gattccattcaagaaattttgatttcttacaatcatgccacactaagtgcaaaggactgg
gggaaggcctggcacacatgggctttgttcaacacagaagtcatgtcacgctatactttc
cgaggtcgaccagatattgctggaaaatatgttgttgcagcagtaactgggtatttctat
tctattgcttgtcaatctactacgaaaggggttgatgatagcttacaggatatccttcgt
ctgttaactctttggttcaaccatggggctacctcagaagttcaaacagcgttgcagaaa
ggcttttcacttgtcaagattgagatgtggctggttgtgctgccccagataattgcaagg
attcattcgaacaccagagtagttagagaactgatacaatctttgctagttcgaattgga
aaggggcatccacaggctttgatgtatcctctcttggttgcctgcaaatcaataagtata
ttgagacaacgtgcagcgcaggaggtcgttgataagatccgccagcacagtggaggtctt
gttgaccaggcacaacttgtatcaaaggaactgatacgggtagcaattttgtggcatgaa
atgtggcatgaggctcttgaggaagctagcaggatgtactttggtgagcacaatattgaa
ggaatgcttgctgtacttgagccattgcatgcaatgcttgagaggggacctgagacaatt
aaagaaaatgccttcattcaggcttatggacatgaattactggaagctcatgaatgctgt
tcgaaatatcgggctacaggagaggatgctgagctaactaaggcctgggatttgtattac
catgttttcagaagaatcgacaaacagcttccaagtcttacaactctcgatttgcactct
gtttcgcctgagctactcaaatgtcgaaagttggaacttgctgtgccaggaacttatgct
gcagattcaccacttgtgacgattgagtattttgttccccaattgattgttataacatcc
aagcaaagaccaagaaaactgacaattcatggaagtgatggcaatgattatgcattcttg
cttaaaggccatgaagatttgcgacaagatgaacgtgtaatgcagctttttggtctggtg
aatactctcctagagaactcaaggaaaacatcagagaaggatttatcaatccaaagatat
gctgttatacctttgtcgcctaacagtggtttaatcggatgggttccaaactgtgacaca
cttcatgctctgatccgtgaatacagagatgccaggaagattttcttgaatcaggagcac
aaacttatgttggcttttgcacccgattatgatcacttacccctcattgcaaaggtggaa
gtgtttcagcatgctttgcaaaacaccgagggaaatgaccttgcaaaggttctgtggctt
aagagtcgaacttcggaagtgtggcttgagcgccgcacaaactacgctagaagcctggct
gttatgagcatggttgggtatttgcttggtttaggagatcgtcacccaagtaatcttatg
ttagatcgctatagtggaaaaatattacacattgactttggagattgctttgaggcttca
atgaatcgagaaaagttccctgaaaaagtaccattccgtttgactagaatgcttgtgaaa
gcaatggaagttagtggtattgagggtacattccgaacaacatgtgaaaatgtgatgcaa
gtccttcgcacaaacagagacagcgttatggccatgatggaggcatttgtacatgaccca
ttaatcaattggcgtctgttcaatttcaatgaggttcctcaagtgtcaaactatggtaat
gctcatgctcacacggttgtcagtagtgaagacgcagtggctaatcgagaactcatgcaa
cctcagcgaggagcacgtgagagggaactgctacaggccgtcaatcaacttggtgatgct
aatgaagttctgaatgagcgtgctgtagctgtgatggcacggatgagtgacaagctaaca
gggcgtgacttctcttctgggtcagctttggctggagcaggtagctcgacccaacatggc
agtgagcacttggcttcaggagatgcccgggatgcgcaacctgctctctcggtgaaggtt
caggttcagaagctcatactccaagccacctcgcacgaaaatttgtgccaaaactatgtc
gggtggtgtccgttctggtga

DBGET integrated database retrieval system