KEGG   Sorghum bicolor (sorghum): SORBI_09g017970Help
Entry
SORBI_09g017970   CDS       T01086                                 

Gene name
SORBIDRAFT_09g017970, Sb09g017970
Definition
hypothetical protein
Orthology
K10527  
enoyl-CoA hydratase/3-hydroxyacyl-CoA dehydrogenase [EC:4.2.1.17 1.1.1.35 1.1.1.211]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Fatty acid degradation
alpha-Linolenic acid metabolism
Metabolic pathways
Fatty acid metabolism
Module
beta-Oxidation
Jasmonic acid biosynthesis
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01212 Fatty acid metabolism
    SORBI_09g017970 (SORBIDRAFT_09g017970)
  Lipid metabolism
   00071 Fatty acid degradation
    SORBI_09g017970 (SORBIDRAFT_09g017970)
   00592 alpha-Linolenic acid metabolism
    SORBI_09g017970 (SORBIDRAFT_09g017970)
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     SORBI_09g017970 (SORBIDRAFT_09g017970)
    1.1.1.211  long-chain-3-hydroxyacyl-CoA dehydrogenase
     SORBI_09g017970 (SORBIDRAFT_09g017970)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     SORBI_09g017970 (SORBIDRAFT_09g017970)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 718 aa AA seqDB search
MARGTTTMEVRADGVAVITISNPPVNALSLDVIASLQRNYTEALSRNDIKAIVLTGAKGR
FCGGFDISAFGKKPKNEKPGSMSIDFLTDIVEDAHKPSVAAIDGIALGGGLELAMVCHAR
ISTPSAQLGLPELQLGIIPGLGGTQRLPRLVGLPKAIEMMLMSKTIKGMGAQELGLVDAV
TSANELVNAACSWALEIVEKKKPWFRSLHRTDKLPDLAEVKDVLKFARVQAKMKGANVQH
PIVCIDVIEEGIVSGPRAGLMKETLSGKMLEQSQTSKSLRHFFFAQRATSKIPNITNMGL
TARKIKKAAIIGGGLMGSGIATILILNNFSVVLKEVNEEFLSTGINRIKANLQSFVKKGQ
LAIEDYKKKLSLLCGVLDYEQFRDTDVVIEAVIEDMFLKQQIFSDLEKYCHHNCIFATNT
STIDLNIIGEKTASQDRIVGAHFFSPAHVMPLLEIVCTHHTSSQVIVDLLDLAKKIQKTP
IVVGNCTGFAVNRMFFPYAQAACFLVDHGLDVYHTDHVITQFGMPMGPFRLADLVGFGVA
IATRKQYYQSYPGRCYKSMILQILVEDNRTGESSRKGFYVYDNKRKASRDPDLGKYIEKS
RNMAGVMQDPKLMKLTDNDIVEMIFFPVVNEACRVLDEGIALKASDLDVASIMGMGFPSY
RGGLMFWADSLGAKYVYDRLDAWSKDYGEFFRPCEYLAVRARQGVSLAAKVDGVKSRL
NT seq 2157 nt NT seq  +upstreamnt  +downstreamnt
atggcgaggggcaccaccaccatggaggtgcgcgcagacggcgtcgccgtcatcaccatc
tccaacccgcccgtcaacgccctctccctcgacgtcattgctagtttgcagaggaactat
acagaggctctaagcaggaatgatatcaaggcaatcgtcctcactggtgccaaaggaagg
ttctgcggcggattcgatatatctgcgtttggaaagaagccaaaaaatgagaagcctgga
tccatgtctattgatttcttgactgacatagtggaagatgcacataaaccgtcagtggct
gctatagatggcattgctctaggaggtgggttggagcttgctatggtttgccatgctcgc
atttcaacaccatcagctcaattaggactacctgaacttcaacttggaatcattcctgga
ctgggagggacgcagcgccttccccgtcttgttggcctgccaaaagccattgagatgatg
ttgatgtcaaagactataaaaggcatgggggcacaagaactcggcttagttgatgctgtt
acttcagctaatgaattggtcaacgctgcctgttcctgggctctagaaattgttgaaaag
aagaaaccatggttcagaagtctccacagaactgataaacttccagatcttgcggaagtg
aaggatgttctgaaatttgcaagagttcaagctaaaatgaagggtgctaatgttcagcat
cccatagtttgcattgatgttattgaagaaggaatagtctctggccctcgtgcaggtctc
atgaaggaaactctgtctggtaaaatgcttgagcagtctcaaacaagcaaaagcttaaga
cacttttttttcgctcagcgtgctacttcaaagattccaaatattaccaacatgggtttg
acagcacggaaaattaaaaaggcagctatcattgggggtggtctaatgggatcaggcatt
gcaacaatattgatattgaacaacttcagtgttgtcttgaaagaagtaaatgaagagttc
ttatctactggcattaacagaattaaagccaatttgcagagtttcgtcaaaaagggtcaa
cttgccatagaagattataaaaagaaactttctctgttatgtggtgttcttgactatgaa
cagttcagagatacagatgtagtcattgaggcagttattgaggatatgtttcttaagcag
caaatattttctgatcttgagaagtattgccatcataattgcatatttgccacaaacact
tcaactatagacctgaacataattggtgagaagacagcttctcaggaccggattgtcggc
gcacacttctttagcccagctcatgtcatgccactgttggaaatagtttgtactcatcat
acttcttctcaagttattgtggacctgcttgatttggcaaagaagatacagaaaacacca
atagttgttggcaactgcacaggtttcgctgtcaatcggatgttctttccttacgctcag
gcagcttgttttcttgttgatcatggtctggatgtgtatcacacagatcatgtgatcaca
caatttggaatgccaatggggcccttccgattagctgatcttgttggttttggtgttgct
attgccacaaggaagcaatattaccagagttatcctggacgatgctacaaatcaatgatt
cttcagattcttgttgaggataataggacaggtgaatcttctcgtaagggcttctatgta
tatgacaataagcgcaaagcctctcgagatcctgatttgggaaagtacattgaaaaatca
aggaacatggcaggtgttatgcaagatcctaagctgatgaaactaacagacaatgacatt
gtggagatgatcttctttcctgtggtgaatgaagcctgccgagtgcttgatgagggaatt
gctctcaaagcatctgaccttgatgtagcttccattatggggatgggtttcccttcttac
aggggtggactaatgttttgggccgactcgcttggtgcgaaatatgtgtacgacagactg
gatgcatggtcgaaggattacggggagttcttcagaccctgtgaatatttagctgtgaga
gctcgtcagggtgtatccctggctgccaaggttgatggtgtcaagtcgcgactctag

DBGET integrated database retrieval system