KEGG   Sorghum bicolor (sorghum): SORBI_09g022310Help
Entry
SORBI_09g022310   CDS       T01086                                 

Gene name
SORBIDRAFT_09g022310, Sb09g022310
Definition
hypothetical protein
Orthology
K12657  
delta-1-pyrroline-5-carboxylate synthetase [EC:2.7.2.11 1.2.1.41]
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    SORBI_09g022310 (SORBIDRAFT_09g022310)
  Amino acid metabolism
   00330 Arginine and proline metabolism
    SORBI_09g022310 (SORBIDRAFT_09g022310)
Enzymes [BR:sbi01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.41  glutamate-5-semialdehyde dehydrogenase
     SORBI_09g022310 (SORBIDRAFT_09g022310)
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     SORBI_09g022310 (SORBIDRAFT_09g022310)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 354 aa AA seqDB search
MATADPTRTFMKDVKRVIIKLGTAVVTRHDGRLALGRLGALCEQVMELNALGYEVIIVTS
GAIGVGKQRLKKRKLVNSSFADLQLPQMELDGKACAAVGQSGLMALYDMLFTQLDVSASQ
LLVTHSDFENPNFRERLRGTVESLLDLKVVPIFNDNDAISTRKALYEDSPGIFWDNDSLA
SVLAIELKADLLVLLSDVDGLYSGPPSEPQSKIIHTYIKDHSEITFGDKSRVGSGGMTAK
VKAAFVASNSGTPVVITSGLASQSIVRVLQGEKIGTLFHKDASMWEPSKDVSAHKMVVAA
RECSGRLQNLSSDEREKILLDVSDALEENEDLIRTENEADVAAAQDTGSSPLLS
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggccaccgcggatccgacccggactttcatgaaggacgtcaaacgcgtcatcatcaag
ttgggcactgcagttgtcacgagacatgatgggcgactggccttaggcaggttaggagct
ctttgtgagcaggtgatggagctgaatgcattaggatacgaggtgatcattgtgacctcc
ggtgctattggtgtggggaagcagaggctcaagaaaaggaagcttgtcaatagcagcttc
gctgatctgcaattgccacagatggagctggatggaaaggcttgcgctgccgttggacag
agtggcctcatggccctttacgatatgctatttacccaacttgatgtatccgcttcccaa
cttcttgtgacacacagtgattttgagaacccaaacttccgggagaggctccgtggaact
gttgagtcactattagatcttaaagttgtcccaatatttaatgataatgatgccatcagc
actagaaaggctctatatgaggattcacctggtatattttgggataatgacagtttagcc
agtgttctggctatagaactcaaagcagatctccttgtcctacttagtgacgtggatggc
ctctacagtggtccaccaagtgaacctcaatcaaagataatacatacctacatcaaagat
cacagtgagattacttttggggataagtcacgtgtaggtagtggaggaatgacagctaaa
gtgaaggctgctttcgtggcttcaaacagtggcacacctgttgttattacaagtggatta
gcgtctcaaagcattgttagagttctccaaggagagaaaattggtactctctttcataag
gacgcaagtatgtgggaaccatccaaagatgttagtgctcataagatggttgttgctgca
agagaatgttcagggcgtctgcagaatttgtcatcggatgagcgagaaaaaatattgcta
gacgtttcagatgctttggaggaaaatgaggatctgattagaactgagaatgaagctgat
gtagctgctgcacaagatactggcagctctcctcttctttcataa

DBGET integrated database retrieval system