KEGG   Sorghum bicolor (sorghum): SORBI_09g023290Help
Entry
SORBI_09g023290   CDS       T01086                                 

Gene name
SORBIDRAFT_09g023290, Sb09g023290
Definition
hypothetical protein
Orthology
K10739  
replication factor A2
Organism
sbi  Sorghum bicolor (sorghum)
Pathway
DNA replication
Nucleotide excision repair
Mismatch repair
Homologous recombination
Module
RPA complex
Brite
KEGG Orthology (KO) [BR:sbi00001]
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    SORBI_09g023290 (SORBIDRAFT_09g023290)
   03420 Nucleotide excision repair
    SORBI_09g023290 (SORBIDRAFT_09g023290)
   03430 Mismatch repair
    SORBI_09g023290 (SORBIDRAFT_09g023290)
   03440 Homologous recombination
    SORBI_09g023290 (SORBIDRAFT_09g023290)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
9
AA seq 242 aa AA seqDB search
MDVDVSKARSILPEERALEGGTRRQSPFREPNRMKVTIKMIRDACGESRDQGRLVINESQ
VFTVELCGMLTRIEQHERWTDYEIYDGTGSIRSRIWPRDEDGYTDMSGSRVGGYYAVNGT
CTVIDGDAMINTLIAREVTNYNSVTEHMLSVIHEHLELGHRLSSNRIVDRMGTKAQLDID
KEGVLMLLSSDEEREKEDGLTEDYIRAKMGLDRDNMRKVLDGLINEGLVYNTVDEYHYKM
AG
NT seq 729 nt NT seq  +upstreamnt  +downstreamnt
atggacgtcgacgtatccaaggcgcgctcaatacttccagaagaaagagcacttgagggc
gggacaaggagacagagtccgtttcgtgaaccaaataggatgaaggtcacgataaagatg
atcagggacgcgtgtggagagtcgagagaccaagggcggctagtaatcaacgagagccag
gtgttcacggtcgagctatgcgggatgctgacaagaatcgaacaacatgaacggtggacg
gactatgagatatacgatggcaccggcagcataagatcgcgtatttggcctagagacgag
gacggctacactgacatgagtgggtcaagagttggggggtactacgccgttaacggcaca
tgcacagtgatagacggcgatgcgatgattaacactttgatcgccagggaggtgaccaac
tacaactccgtgactgaacacatgttgagcgtcatacatgagcatctggagcttggacac
cgactcagttcaaacagaattgtagacagaatggggacaaaggcgcaattagacatcgac
aaggaaggtgttctcatgctactttcaagtgatgaggaaagggaaaaggaggatgggttg
acggaggattacatcagggcgaaaatgggcctagatagagacaacatgaggaaggtcctg
gatggattgatcaacgaagggctagtttacaacacggtggacgagtatcactacaagatg
gcagggtag

DBGET integrated database retrieval system